Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 113 (26 Feb 2020)
Sequence version 1 (03 Oct 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Proteasomal ubiquitin receptor ADRM1 homolog

Gene

Rpn13

Organism
Drosophila melanogaster (Fruit fly)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May function as a proteasomal ubiquitin receptor. May promote the deubiquitinating activity associated with the 26S proteasome (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-DME-5689603 UCH proteinases
R-DME-5689880 Ub-specific processing proteases

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Proteasomal ubiquitin receptor ADRM1 homolog
Alternative name(s):
Regulatory particle non-ATPase 13 protein
p42E
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Rpn13
ORF Names:CG13349
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiDrosophila melanogaster (Fruit fly)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri7227 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaEcdysozoaArthropodaHexapodaInsectaPterygotaNeopteraHolometabolaDipteraBrachyceraMuscomorphaEphydroideaDrosophilidaeDrosophilaSophophora
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000803 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2R

Organism-specific databases

Drosophila genome database

More...
FlyBasei
FBgn0033886 Rpn13

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Nucleus, Proteasome

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002860751 – 389Proteasomal ubiquitin receptor ADRM1 homologAdd BLAST389

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei6Phosphoserine2 Publications1
Modified residuei185Phosphoserine1 Publication1
Modified residuei196Phosphothreonine1 Publication1
Modified residuei205Phosphothreonine1 Publication1
Modified residuei207Phosphoserine1 Publication1
Modified residuei217Phosphoserine2 Publications1
Modified residuei218Phosphoserine1 Publication1
Modified residuei219Phosphoserine2 Publications1
Modified residuei367Phosphothreonine1 Publication1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PRoteomics IDEntifications database

More...
PRIDEi
Q7K2G1

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q7K2G1

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

In larvae, expressed in the central nervous system.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
FBgn0033886 Expressed in secondary oocyte and 32 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q7K2G1 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q7K2G1 DM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with the 26S proteasome.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
Q9V3I93EBI-88589,EBI-115777

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
62299, 45 interactors

Protein interaction database and analysis system

More...
IntActi
Q7K2G1, 9 interactors

STRING: functional protein association networks

More...
STRINGi
7227.FBpp0112985

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini16 – 124PHAdd BLAST109

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The PH domain mediates interactions with PSMD1 and ubiquitin. Preferential binding to the proximal subunit of K48-linked diubiquitin allows UCHL5 access to the distal subunit (By similarity).By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ADRM1 family.Curated

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000013839

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_041798_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q7K2G1

KEGG Orthology (KO)

More...
KOi
K06691

Identification of Orthologs from Complete Genome Data

More...
OMAi
HCRRINE

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.70, 1 hit
3.40.190.140, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR006773 Rpn13/ADRM1
IPR038633 Rpn13/ADRM1_sf
IPR032368 RPN13_C
IPR038108 RPN13_C_sf

The PANTHER Classification System

More...
PANTHERi
PTHR12225 PTHR12225, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04683 Proteasom_Rpn13, 1 hit
PF16550 RPN13_C, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q7K2G1-1) [UniParc]FASTAAdd to basket
Also known as: A, B, F

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MFGRQSGLGS SSNSSNLVEF RAGRMNMVGK MVHPDPRKGL VYMTQSDDGL
60 70 80 90 100
MHFCWKDRTS GKVEDDLIVF PDDFEYKRVD QCKTGRVYVL KFKSSTRRMF
110 120 130 140 150
FWMQEPKTDK DDEQCRRINE LLNNPPSAHQ RGGGGSNDGD LQYMLNNMSQ
160 170 180 190 200
QQLMQLFGGV GQMGGLSSLL GQMNSRTPSS RNTSSSGGGG ASALQTPENV
210 220 230 240 250
SVPRTPSAPS KSGSSRSSSN VNSQVGEGAG SSVDADAPGR SLNIDLSTAL
260 270 280 290 300
PGADAINQII ADPEHVKTLI VHLPESEDVD DDRKQQIKDN ITSPQFQQAL
310 320 330 340 350
AQFSSALQSA QLGPVIKQFE LSNEAVAAAF SGNLEDFVRA LEKSLPPGAT
360 370 380
MGGKPSASEK KASDPETPTS VARDENTDPA TEKQEEKQK
Length:389
Mass (Da):42,013
Last modified:October 3, 2006 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i260F2383BF6C7BFF
GO
Isoform 2 (identifier: Q7K2G1-2) [UniParc]FASTAAdd to basket
Also known as: D, E

The sequence of this isoform differs from the canonical sequence as follows:
     238-238: P → PGKNSTTSTTTASKSTGAYANPFQAYLSNLSPEHGA

Show »
Length:424
Mass (Da):45,555
Checksum:iC3744B91B17150C5
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0B4LFA6A0A0B4LFA6_DROME
Regulatory particle non-ATPase 13, ...
Rpn13 Dmel\CG13349, GC13349, p42E, CG13349, Dmel_CG13349
424Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_024972238P → PGKNSTTSTTTASKSTGAYA NPFQAYLSNLSPEHGA in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AE013599 Genomic DNA Translation: AAF58312.1
AE013599 Genomic DNA Translation: AAG22269.1
AE013599 Genomic DNA Translation: ACL83116.1
AE013599 Genomic DNA Translation: ACL83117.1
AE013599 Genomic DNA Translation: ACL83118.1
AY061027 mRNA Translation: AAL28575.1
BT003652 mRNA Translation: AAO39656.1

NCBI Reference Sequences

More...
RefSeqi
NP_001137662.1, NM_001144190.2 [Q7K2G1-2]
NP_001137663.1, NM_001144191.2 [Q7K2G1-2]
NP_001137664.1, NM_001144192.2 [Q7K2G1-1]
NP_001286397.1, NM_001299468.1 [Q7K2G1-2]
NP_610917.1, NM_137073.3 [Q7K2G1-1]
NP_725346.1, NM_166025.2 [Q7K2G1-1]

Genome annotation databases

Ensembl metazoan genome annotation project

More...
EnsemblMetazoai
FBtr0087610; FBpp0086736; FBgn0033886 [Q7K2G1-1]
FBtr0087611; FBpp0086737; FBgn0033886 [Q7K2G1-1]
FBtr0114493; FBpp0112985; FBgn0033886 [Q7K2G1-2]
FBtr0114494; FBpp0112986; FBgn0033886 [Q7K2G1-2]
FBtr0114495; FBpp0112987; FBgn0033886 [Q7K2G1-1]
FBtr0339958; FBpp0308980; FBgn0033886 [Q7K2G1-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
36545

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
dme:Dmel_CG13349

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AE013599 Genomic DNA Translation: AAF58312.1
AE013599 Genomic DNA Translation: AAG22269.1
AE013599 Genomic DNA Translation: ACL83116.1
AE013599 Genomic DNA Translation: ACL83117.1
AE013599 Genomic DNA Translation: ACL83118.1
AY061027 mRNA Translation: AAL28575.1
BT003652 mRNA Translation: AAO39656.1
RefSeqiNP_001137662.1, NM_001144190.2 [Q7K2G1-2]
NP_001137663.1, NM_001144191.2 [Q7K2G1-2]
NP_001137664.1, NM_001144192.2 [Q7K2G1-1]
NP_001286397.1, NM_001299468.1 [Q7K2G1-2]
NP_610917.1, NM_137073.3 [Q7K2G1-1]
NP_725346.1, NM_166025.2 [Q7K2G1-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi62299, 45 interactors
IntActiQ7K2G1, 9 interactors
STRINGi7227.FBpp0112985

PTM databases

iPTMnetiQ7K2G1

Proteomic databases

PRIDEiQ7K2G1

Genome annotation databases

EnsemblMetazoaiFBtr0087610; FBpp0086736; FBgn0033886 [Q7K2G1-1]
FBtr0087611; FBpp0086737; FBgn0033886 [Q7K2G1-1]
FBtr0114493; FBpp0112985; FBgn0033886 [Q7K2G1-2]
FBtr0114494; FBpp0112986; FBgn0033886 [Q7K2G1-2]
FBtr0114495; FBpp0112987; FBgn0033886 [Q7K2G1-1]
FBtr0339958; FBpp0308980; FBgn0033886 [Q7K2G1-2]
GeneIDi36545
KEGGidme:Dmel_CG13349

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
36545
FlyBaseiFBgn0033886 Rpn13

Phylogenomic databases

GeneTreeiENSGT00390000013839
HOGENOMiCLU_041798_2_0_1
InParanoidiQ7K2G1
KOiK06691
OMAiHCRRINE

Enzyme and pathway databases

ReactomeiR-DME-5689603 UCH proteinases
R-DME-5689880 Ub-specific processing proteases

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
36545

Protein Ontology

More...
PROi
PR:Q7K2G1

Gene expression databases

BgeeiFBgn0033886 Expressed in secondary oocyte and 32 other tissues
ExpressionAtlasiQ7K2G1 baseline and differential
GenevisibleiQ7K2G1 DM

Family and domain databases

Gene3Di2.30.29.70, 1 hit
3.40.190.140, 1 hit
InterProiView protein in InterPro
IPR006773 Rpn13/ADRM1
IPR038633 Rpn13/ADRM1_sf
IPR032368 RPN13_C
IPR038108 RPN13_C_sf
PANTHERiPTHR12225 PTHR12225, 1 hit
PfamiView protein in Pfam
PF04683 Proteasom_Rpn13, 1 hit
PF16550 RPN13_C, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiADRM1_DROME
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q7K2G1
Secondary accession number(s): B7YZG7, B7YZG8, Q86NT4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 2007
Last sequence update: October 3, 2006
Last modified: February 26, 2020
This is version 113 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programDrosophila annotation project

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Drosophila
    Drosophila: entries, gene names and cross-references to FlyBase
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again