Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Trafficking protein particle complex subunit 6A

Gene

Trappc6a

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May play a role in vesicular transport during the biogenesis of melanosomes.1 Publication

GO - Biological processi

  • ER to Golgi vesicle-mediated transport Source: GO_Central
  • melanosome assembly Source: MGI
  • pigmentation Source: MGI
  • regulation of GTPase activity Source: InterPro

Keywordsi

Biological processER-Golgi transport, Transport

Enzyme and pathway databases

ReactomeiR-MMU-204005 COPII-mediated vesicle transport
R-MMU-8876198 RAB GEFs exchange GTP for GDP on RABs

Names & Taxonomyi

Protein namesi
Recommended name:
Trafficking protein particle complex subunit 6ABy similarity
Short name:
TRAPP complex subunit 6A
Gene namesi
Name:Trappc6a1 PublicationImported
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 7

Organism-specific databases

MGIiMGI:1914341 Trappc6a

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Endoplasmic reticulum, Golgi apparatus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002115861 – 159Trafficking protein particle complex subunit 6AAdd BLAST159

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei33PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ78XR0
PaxDbiQ78XR0
PRIDEiQ78XR0

PTM databases

iPTMnetiQ78XR0
PhosphoSitePlusiQ78XR0

Expressioni

Tissue specificityi

Ubiquitous, with lowest expression in skeletal muscle and brain and highest in kidney, liver and testis, as well as in cultured melanocytes.1 Publication

Gene expression databases

BgeeiENSMUSG00000002043 Expressed in 218 organ(s), highest expression level in cardiac ventricle
CleanExiMM_TRAPPC6A
ExpressionAtlasiQ78XR0 baseline and differential
GenevisibleiQ78XR0 MM

Interactioni

Subunit structurei

Part of the multisubunit transport protein particle (TRAPP) complex. Heterodimer with TRAPPC3 (By similarity). The heterodimer TRAPPC3-TRAPPC6A interacts with TRAPPC2L. Interacts with TRAPPC2L (By similarity).By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000002112

Structurei

3D structure databases

ProteinModelPortaliQ78XR0
SMRiQ78XR0
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG3316 Eukaryota
ENOG410YUYH LUCA
GeneTreeiENSGT00390000012948
HOGENOMiHOG000200502
HOVERGENiHBG056159
InParanoidiQ78XR0
KOiK20304
OMAiGFRVGQA
OrthoDBiEOG091G0MJ1
PhylomeDBiQ78XR0
TreeFamiTF313010

Family and domain databases

CDDicd14944 TRAPPC6A_Trs33, 1 hit
InterProiView protein in InterPro
IPR024096 NO_sig/Golgi_transp_ligand-bd
IPR007194 TRAPP_component
IPR037992 TRAPPC6/Trs33
PANTHERiPTHR12817 PTHR12817, 1 hit
PfamiView protein in Pfam
PF04051 TRAPP, 1 hit
SUPFAMiSSF111126 SSF111126, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q78XR0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MADAVLFEFL HTEMVAELWA PDPDPGSGGK RRSLSVLEGL GFRVGQALGE
60 70 80 90 100
RLPLETPAFR EELDALKFLC RDLWAAMFQK HMDGLRTNHQ GTYVLQDNSF
110 120 130 140 150
PLLVTMGSGP QYLEEAPKFL AFTCGLLCGA LHTLGFQSLV TASVASLPAC

KFQVVIQKS
Length:159
Mass (Da):17,430
Last modified:July 5, 2004 - v1
Checksum:iD3A80F6C88ABD152
GO
Isoform 2 (identifier: Q78XR0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     151-159: KFQVVIQKS → RLEAGAHRLWGGHMCFRQGNERAGRVPGGGTIP

Show »
Length:183
Mass (Da):19,899
Checksum:i13CA6D3AC007EB13
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F6VKM0F6VKM0_MOUSE
Trafficking protein particle comple...
Trappc6a
81Annotation score:
D6RD01D6RD01_MOUSE
Trafficking protein particle comple...
Trappc6a
36Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti4A → V in BAB25415 (PubMed:16141072).Curated1
Sequence conflicti54L → R in BAC40600 (PubMed:16141072).Curated1
Sequence conflicti70C → S in BAB25415 (PubMed:16141072).Curated1
Sequence conflicti114E → K in BAB25681 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_019586151 – 159KFQVVIQKS → RLEAGAHRLWGGHMCFRQGN ERAGRVPGGGTIP in isoform 2. 1 Publication9

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK007965 mRNA Translation: BAB25376.1
AK008022 mRNA Translation: BAB25415.1
AK008462 mRNA Translation: BAB25681.2
AK088832 mRNA Translation: BAC40600.1
BC037154 mRNA Translation: AAH37154.1
BC106114 mRNA Translation: AAI06115.1
CCDSiCCDS20905.1 [Q78XR0-1]
RefSeqiNP_001318110.1, NM_001331181.1 [Q78XR0-2]
NP_080236.2, NM_025960.4 [Q78XR0-1]
UniGeneiMm.44213
Mm.442903

Genome annotation databases

EnsembliENSMUST00000002112; ENSMUSP00000002112; ENSMUSG00000002043 [Q78XR0-1]
ENSMUST00000108455; ENSMUSP00000104095; ENSMUSG00000002043 [Q78XR0-2]
GeneIDi67091
KEGGimmu:67091
UCSCiuc009fmb.1 mouse [Q78XR0-2]
uc009fmc.1 mouse [Q78XR0-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK007965 mRNA Translation: BAB25376.1
AK008022 mRNA Translation: BAB25415.1
AK008462 mRNA Translation: BAB25681.2
AK088832 mRNA Translation: BAC40600.1
BC037154 mRNA Translation: AAH37154.1
BC106114 mRNA Translation: AAI06115.1
CCDSiCCDS20905.1 [Q78XR0-1]
RefSeqiNP_001318110.1, NM_001331181.1 [Q78XR0-2]
NP_080236.2, NM_025960.4 [Q78XR0-1]
UniGeneiMm.44213
Mm.442903

3D structure databases

ProteinModelPortaliQ78XR0
SMRiQ78XR0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000002112

PTM databases

iPTMnetiQ78XR0
PhosphoSitePlusiQ78XR0

Proteomic databases

EPDiQ78XR0
PaxDbiQ78XR0
PRIDEiQ78XR0

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000002112; ENSMUSP00000002112; ENSMUSG00000002043 [Q78XR0-1]
ENSMUST00000108455; ENSMUSP00000104095; ENSMUSG00000002043 [Q78XR0-2]
GeneIDi67091
KEGGimmu:67091
UCSCiuc009fmb.1 mouse [Q78XR0-2]
uc009fmc.1 mouse [Q78XR0-1]

Organism-specific databases

CTDi79090
MGIiMGI:1914341 Trappc6a

Phylogenomic databases

eggNOGiKOG3316 Eukaryota
ENOG410YUYH LUCA
GeneTreeiENSGT00390000012948
HOGENOMiHOG000200502
HOVERGENiHBG056159
InParanoidiQ78XR0
KOiK20304
OMAiGFRVGQA
OrthoDBiEOG091G0MJ1
PhylomeDBiQ78XR0
TreeFamiTF313010

Enzyme and pathway databases

ReactomeiR-MMU-204005 COPII-mediated vesicle transport
R-MMU-8876198 RAB GEFs exchange GTP for GDP on RABs

Miscellaneous databases

PROiPR:Q78XR0
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000002043 Expressed in 218 organ(s), highest expression level in cardiac ventricle
CleanExiMM_TRAPPC6A
ExpressionAtlasiQ78XR0 baseline and differential
GenevisibleiQ78XR0 MM

Family and domain databases

CDDicd14944 TRAPPC6A_Trs33, 1 hit
InterProiView protein in InterPro
IPR024096 NO_sig/Golgi_transp_ligand-bd
IPR007194 TRAPP_component
IPR037992 TRAPPC6/Trs33
PANTHERiPTHR12817 PTHR12817, 1 hit
PfamiView protein in Pfam
PF04051 TRAPP, 1 hit
SUPFAMiSSF111126 SSF111126, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiTPC6A_MOUSE
AccessioniPrimary (citable) accession number: Q78XR0
Secondary accession number(s): Q3KQP0
, Q8C2C8, Q9CQ27, Q9D8H6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2005
Last sequence update: July 5, 2004
Last modified: October 10, 2018
This is version 100 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again