UniProtKB - Q76QK7 (Q76QK7_COWPX)
(max 400 entries)x
Your basket is currently empty. i <p>When browsing through different UniProt proteins, you can use the ‘basket’ to save them, so that you can back to find or analyse them later.<p><a href='/help/basket' target='_top'>More...</a></p>
Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)
- BLAST>tr|Q76QK7|Q76QK7_COWPX CPXV084 protein OS=Cowpox virus OX=10243 GN=L5L PE=4 SV=1 MVDAITVLTAIGITVLMLLMVISGAAMIVKELNPNDIFTMQSLKFNRAVTIFKYIGLFIY IPGTIILYATYVKSLLMKS
- Align
- Format
- Add to basketAdded to basket
- History
- Other tutorials and videos
- Help video
- Feedback
Protein
Submitted name:
CPXV084 protein
Gene
L5L
Organism
Cowpox virus (CPV)
Status
Unreviewed-Annotation score:
Annotation score:1 out of 5
<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Protein predictedi <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>Select a section on the left to see content.
<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi | Submitted name: CPXV084 proteinImported<p>Information which has been imported from another database using automatic procedures.</p> <p><a href="/manual/evidences#ECO:0000313">More...</a></p> Automatic assertion inferred from database entriesi Submitted name: IMV protein VP13Imported<p>Information which has been imported from another database using automatic procedures.</p> <p><a href="/manual/evidences#ECO:0000313">More...</a></p> Automatic assertion inferred from database entriesi Submitted name: L5L proteinImported<p>Information which has been imported from another database using automatic procedures.</p> <p><a href="/manual/evidences#ECO:0000313">More...</a></p> Automatic assertion inferred from database entriesi |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi | Name:L5LImported <p>Information which has been imported from another database using automatic procedures.</p> <p><a href="/manual/evidences#ECO:0000313">More...</a></p> Automatic assertion inferred from database entriesi Synonyms:CPXV084Imported <p>Information which has been imported from another database using automatic procedures.</p> <p><a href="/manual/evidences#ECO:0000313">More...</a></p> Automatic assertion inferred from database entriesi ORF Names:CPXV_FIN2000_MAN_079Imported <p>Information which has been imported from another database using automatic procedures.</p> <p><a href="/manual/evidences#ECO:0000313">More...</a></p> Automatic assertion inferred from database entriesi , CPXV_GER1998_2_079Imported<p>Information which has been imported from another database using automatic procedures.</p> <p><a href="/manual/evidences#ECO:0000313">More...</a></p> Automatic assertion inferred from database entriesi , CPXV_GER2002_MKY_079Imported<p>Information which has been imported from another database using automatic procedures.</p> <p><a href="/manual/evidences#ECO:0000313">More...</a></p> Automatic assertion inferred from database entriesi , CPXV_GER91_3_079Imported<p>Information which has been imported from another database using automatic procedures.</p> <p><a href="/manual/evidences#ECO:0000313">More...</a></p> Automatic assertion inferred from database entriesi |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>Organismi | Cowpox virus (CPV)Imported <p>Information which has been imported from another database using automatic procedures.</p> <p><a href="/manual/evidences#ECO:0000313">More...</a></p> Automatic assertion inferred from database entriesi |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri | 10243 [NCBI] |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineagei | Viruses › dsDNA viruses, no RNA stage › Poxviridae › Chordopoxvirinae › Orthopoxvirus |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section only exists in viral entries and indicates the host(s) either as a specific organism or taxonomic group of organisms that are susceptible to be infected by a virus.<p><a href='/help/virus_host' target='_top'>More...</a></p>Virus hosti | Apodemus sylvaticus (European woodmouse) [TaxID: 10129] Bos taurus (Bovine) [TaxID: 9913] Felis catus (Cat) (Felis silvestris catus) [TaxID: 9685] Homo sapiens (Human) [TaxID: 9606] Loxodonta africana (African elephant) [TaxID: 9785] Microtus agrestis (Short-tailed field vole) [TaxID: 29092] Mus musculus (Mouse) [TaxID: 10090] Myodes glareolus (Bank vole) (Clethrionomys glareolus) [TaxID: 447135] |
| <p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi |
|
<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi
Topology
| Feature key | Position(s) | DescriptionActions | Graphical view | Length |
|---|---|---|---|---|
| <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei | 6 – 29 | HelicalSequence analysis <p>Information which has been generated by the UniProtKB automatic annotation system, without manual validation.</p> <p><a href="/manual/evidences#ECO:0000256">More...</a></p> Automatic assertion according to rulesi Add BLAST | 24 | |
| <p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei | 50 – 71 | HelicalSequence analysis <p>Information which has been generated by the UniProtKB automatic annotation system, without manual validation.</p> <p><a href="/manual/evidences#ECO:0000256">More...</a></p> Automatic assertion according to rulesi Add BLAST | 22 |
<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Cellular componenti
- integral component of membrane Source: UniProtKB-KW
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti
Membrane<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Domaini
Transmembrane, Transmembrane helixSequence analysis<p>Information which has been generated by the UniProtKB automatic annotation system, without manual validation.</p> <p><a href="/manual/evidences#ECO:0000256">More...</a></p> Automatic assertion according to rulesi
Family and domain databases
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR006803 Poxvirus_I5 |
Pfam protein domain database More...Pfami | View protein in Pfam PF04713 Pox_I5, 1 hit |
PIRSF; a whole-protein classification database More...PIRSFi | PIRSF003768 VAC_I5L, 1 hit |
ProDom; a protein domain database More...ProDomi | View protein in ProDom or Entries sharing at least one domain PD012198 Pox_I5, 1 hit |
<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequencei
<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.
Q76QK7-1 [UniParc]FASTAAdd to basketAdded to basketShow »
10 20 30 40 50
MVDAITVLTA IGITVLMLLM VISGAAMIVK ELNPNDIFTM QSLKFNRAVT
60 70
IFKYIGLFIY IPGTIILYAT YVKSLLMKS
Length:79
Mass (Da):8,762
Last modified:July 5, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated
from the sequence. It is useful for tracking sequence updates.</p>
<p>It should be noted that while, in theory, two different sequences could
have the same checksum value, the likelihood that this would happen
is extremely low.</p>
<p>However UniProtKB may contain entries with identical sequences in case
of multiple genes (paralogs).</p>
<p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64)
using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1.
The algorithm is described in the ISO 3309 standard.
</p>
<p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br />
<strong>Cyclic redundancy and other checksums</strong><br />
<a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p>
Checksum:i76F4826B7009DFAF
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | DQ437593 Genomic DNA Translation: ABD97426.1 HQ420893 Genomic DNA Translation: ADZ29196.1 HQ420897 Genomic DNA Translation: ADZ30053.1 HQ420898 Genomic DNA Translation: ADZ30267.1 KC813491 Genomic DNA Translation: AGY97209.1 KC813492 Genomic DNA Translation: AGY97423.1 KC813493 Genomic DNA Translation: AGY97640.1 KC813495 Genomic DNA Translation: AGY98078.1 KC813497 Genomic DNA Translation: AGY98498.1 KC813498 Genomic DNA Translation: AGY98714.1 KC813500 Genomic DNA Translation: AGY99144.1 KC813501 Genomic DNA Translation: AGY99353.1 KC813502 Genomic DNA Translation: AGY99559.1 KC813503 Genomic DNA Translation: AGY99774.1 KC813504 Genomic DNA Translation: AGY99987.1 KC813505 Genomic DNA Translation: AGZ00204.1 KC813506 Genomic DNA Translation: AGZ00418.1 KC813507 Genomic DNA Translation: AGZ00626.1 KC813508 Genomic DNA Translation: AGZ00835.1 KC813509 Genomic DNA Translation: AGZ01044.1 KC813510 Genomic DNA Translation: AGZ01258.1 KC813511 Genomic DNA Translation: AGZ01469.1 KC813512 Genomic DNA Translation: AGZ01678.1 KY369926 Genomic DNA Translation: AQQ12942.1 KY463519 Genomic DNA Translation: ARB50308.1 X94355 Genomic DNA Translation: CAD90623.1 LN864565 Genomic DNA Translation: CRL86547.1 LN864566 Genomic DNA Translation: CRL86843.1 LN879483 Genomic DNA Translation: CUI02321.1 LT896730 Genomic DNA Translation: SNB48228.1 LT896719 Genomic DNA Translation: SNB48856.1 LT896722 Genomic DNA Translation: SNB49246.1 LT896718 Genomic DNA Translation: SNB50008.1 LT896729 Genomic DNA Translation: SNB50045.1 LT896726 Genomic DNA Translation: SNB50163.1 LT896731 Genomic DNA Translation: SNB50294.1 LT896733 Genomic DNA Translation: SNB51410.1 LT896728 Genomic DNA Translation: SNB52832.1 LT896720 Genomic DNA Translation: SNB53308.1 LT896721 Genomic DNA Translation: SNB53919.1 LT896725 Genomic DNA Translation: SNB56491.1 LT896723 Genomic DNA Translation: SNB57625.1 LT896727 Genomic DNA Translation: SNB68504.1 LT993228 Genomic DNA Translation: SPN68176.1 LT993230 Genomic DNA Translation: SPN68455.1 LT993231 Genomic DNA Translation: SPN68736.1 LT993232 Genomic DNA Translation: SPN69016.1 LT896732 Genomic DNA Translation: SPQ84268.1 |
<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| Q76QK7 | Protein I5 | 79 | |||
| IMV protein VP13 | 79 | ||||
| IMV protein VP13 | 79 | ||||
| IMV protein VP13 | 79 | ||||
| Membrane nucleoprotein | 79 | ||||
| +1 | |||||
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| Q76QK7 | Protein I5 | 79 | |||
| IMV protein VP13 | 79 | ||||
| CPXV084 protein | 79 | ||||
| HSPV075 | 79 | ||||
| Minor membrane component of the virion | 79 | ||||
| +32 | |||||
| Protein | Similar proteins | Species | Score | Length | |
|---|---|---|---|---|---|
| Q76QK7 | Protein I5 | 79 | |||
| IMV protein VP13 | 79 | ||||
| CPXV084 protein | 79 | ||||
| HSPV075 | 79 | ||||
| Minor membrane component of the virion | 79 | ||||
| +35 | |||||
<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi
Sequence databases
| Select the link destinations: EMBL nucleotide sequence database More...EMBLiGenBank nucleotide sequence database More...GenBankiDNA Data Bank of Japan; a nucleotide sequence database More...DDBJiLinks Updated | DQ437593 Genomic DNA Translation: ABD97426.1 HQ420893 Genomic DNA Translation: ADZ29196.1 HQ420897 Genomic DNA Translation: ADZ30053.1 HQ420898 Genomic DNA Translation: ADZ30267.1 KC813491 Genomic DNA Translation: AGY97209.1 KC813492 Genomic DNA Translation: AGY97423.1 KC813493 Genomic DNA Translation: AGY97640.1 KC813495 Genomic DNA Translation: AGY98078.1 KC813497 Genomic DNA Translation: AGY98498.1 KC813498 Genomic DNA Translation: AGY98714.1 KC813500 Genomic DNA Translation: AGY99144.1 KC813501 Genomic DNA Translation: AGY99353.1 KC813502 Genomic DNA Translation: AGY99559.1 KC813503 Genomic DNA Translation: AGY99774.1 KC813504 Genomic DNA Translation: AGY99987.1 KC813505 Genomic DNA Translation: AGZ00204.1 KC813506 Genomic DNA Translation: AGZ00418.1 KC813507 Genomic DNA Translation: AGZ00626.1 KC813508 Genomic DNA Translation: AGZ00835.1 KC813509 Genomic DNA Translation: AGZ01044.1 KC813510 Genomic DNA Translation: AGZ01258.1 KC813511 Genomic DNA Translation: AGZ01469.1 KC813512 Genomic DNA Translation: AGZ01678.1 KY369926 Genomic DNA Translation: AQQ12942.1 KY463519 Genomic DNA Translation: ARB50308.1 X94355 Genomic DNA Translation: CAD90623.1 LN864565 Genomic DNA Translation: CRL86547.1 LN864566 Genomic DNA Translation: CRL86843.1 LN879483 Genomic DNA Translation: CUI02321.1 LT896730 Genomic DNA Translation: SNB48228.1 LT896719 Genomic DNA Translation: SNB48856.1 LT896722 Genomic DNA Translation: SNB49246.1 LT896718 Genomic DNA Translation: SNB50008.1 LT896729 Genomic DNA Translation: SNB50045.1 LT896726 Genomic DNA Translation: SNB50163.1 LT896731 Genomic DNA Translation: SNB50294.1 LT896733 Genomic DNA Translation: SNB51410.1 LT896728 Genomic DNA Translation: SNB52832.1 LT896720 Genomic DNA Translation: SNB53308.1 LT896721 Genomic DNA Translation: SNB53919.1 LT896725 Genomic DNA Translation: SNB56491.1 LT896723 Genomic DNA Translation: SNB57625.1 LT896727 Genomic DNA Translation: SNB68504.1 LT993228 Genomic DNA Translation: SPN68176.1 LT993230 Genomic DNA Translation: SPN68455.1 LT993231 Genomic DNA Translation: SPN68736.1 LT993232 Genomic DNA Translation: SPN69016.1 LT896732 Genomic DNA Translation: SPQ84268.1 |
3D structure databases
Database of comparative protein structure models More...ModBasei | Search... |
MobiDB: a database of protein disorder and mobility annotations More...MobiDBi | Search... |
Protocols and materials databases
| Structural Biology Knowledgebase | Search... |
Family and domain databases
Integrated resource of protein families, domains and functional sites More...InterProi | View protein in InterPro IPR006803 Poxvirus_I5 |
Pfam protein domain database More...Pfami | View protein in Pfam PF04713 Pox_I5, 1 hit |
PIRSF; a whole-protein classification database More...PIRSFi | PIRSF003768 VAC_I5L, 1 hit |
ProDom; a protein domain database More...ProDomi | View protein in ProDom or Entries sharing at least one domain PD012198 Pox_I5, 1 hit |
ProtoNet; Automatic hierarchical classification of proteins More...ProtoNeti | Search... |
<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi
| <p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei | Q76QK7_COWPX | |
| <p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>Accessioni | Q76QK7Primary (citable) accession number: Q76QK7 | |
| <p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyi | Integrated into UniProtKB/TrEMBL: | July 5, 2004 |
| Last sequence update: | July 5, 2004 | |
| Last modified: | July 18, 2018 | |
| This is version 46 of the entry and version 1 of the sequence. See complete history. | ||
| <p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusi | Unreviewed (UniProtKB/TrEMBL) | |
<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi
<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Technical termi
Complete proteomeImported<p>Information which has been imported from another database using automatic procedures.</p> <p><a href="/manual/evidences#ECO:0000313">More...</a></p> Automatic assertion inferred from database entriesi
