Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

MTSS1-like protein

Gene

MTSS1L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Involved in plasma membrane dynamics. Potentiated PDGF-mediated formation of membrane ruffles and lamellipodia in fibroblasts, acting via RAC1 activation (PubMed:14752106). May function in actin bundling (PubMed:14752106).1 Publication

GO - Molecular functioni

  • actin monomer binding Source: Ensembl
  • GTPase activator activity Source: UniProtKB
  • phosphatidylinositol-4,5-bisphosphate binding Source: Ensembl
  • Rac GTPase binding Source: UniProtKB

GO - Biological processi

Keywordsi

Molecular functionActin-binding

Names & Taxonomyi

Protein namesi
Recommended name:
MTSS1-like protein
Alternative name(s):
Actin-bundling with BAIAP2 homology protein 1
Short name:
ABBA-1
Gene namesi
Name:MTSS1L
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000132613.14
HGNCiHGNC:25094 MTSS1L
MIMi616951 gene
neXtProtiNX_Q765P7

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi115K → D: Marked reduction in RAC1-binding, loss of increase in RAC1 activity and of dorsal ruffles formation in response to PDGF treatment; when associated with D-116, D-123, D-127, D-130, D-137, D-138, D-139, D-145, D-148, D-149, D-152 and D-157. 1 Publication1
Mutagenesisi116K → D: Marked reduction in RAC1-binding, loss of increase in RAC1 activity and of dorsal ruffles formation in response to PDGF treatment; when associated with D-115, D-123, D-127, D-130, D-137, D-138, D-139, D-145, D-148, D-149, D-152 and D-157. 1 Publication1
Mutagenesisi123K → D: Marked reduction in RAC1-binding, loss of increase in RAC1 activity and of dorsal ruffles formation in response to PDGF treatment; when associated with D-115, D-116, D-127, D-130, D-137, D-138, D-139, D-145, D-148, D-149, D-152 and D-157. 1 Publication1
Mutagenesisi127K → D: Marked reduction in RAC1-binding, loss of increase in RAC1 activity and of dorsal ruffles formation in response to PDGF treatment; when associated with D-115, D-116, D-123, D-130, D-137, D-138, D-139, D-145, D-148, D-149, D-152 and D-157. 1 Publication1
Mutagenesisi130K → D: Marked reduction in RAC1-binding, loss of increase in RAC1 activity and of dorsal ruffles formation in response to PDGF treatment; when associated with D-115, D-116, D-123, D-127, D-137, D-138, D-139, D-145, D-148, D-149, D-152 and D-157. 1 Publication1
Mutagenesisi137K → D: Marked reduction in RAC1-binding, loss of increase in RAC1 activity and of dorsal ruffles formation in response to PDGF treatment; when associated with D-115, D-116, D-123, D-127, D-130, D-138, D-139, D-145, D-148, D-149, D-152 and D-157. 1 Publication1
Mutagenesisi138K → D: Marked reduction in RAC1-binding, loss of increase in RAC1 activity and of dorsal ruffles formation in response to PDGF treatment; when associated with D-115, D-116, D-123, D-127, D-130, D-137, D-139, D-145, D-148, D-149, D-152 and D-157. 1 Publication1
Mutagenesisi139K → D: Marked reduction in RAC1-binding, loss of increase in RAC1 activity and of dorsal ruffles formation in response to PDGF treatment; when associated with D-115, D-116, D-123, D-127, D-130, D-137, D-138, D-145, D-148, D-149, D-152 and D-157. 1 Publication1
Mutagenesisi145K → D: Marked reduction in RAC1-binding, loss of increase in RAC1 activity and of dorsal ruffles formation in response to PDGF treatment; when associated with D-115, D-116, D-123, D-127, D-130, D-137, D-138, D-139, D-148, D-149, D-152 and D-157. 1 Publication1
Mutagenesisi148K → D: Marked reduction in RAC1-binding, loss of increase in RAC1 activity and of dorsal ruffles formation in response to PDGF treatment; when associated with D-115, D-116, D-123, D-127, D-130, D-137, D-138, D-139, D-145, D-149, D-152 and D-157. 1 Publication1
Mutagenesisi149K → D: Marked reduction in RAC1-binding, loss of increase in RAC1 activity and of dorsal ruffles formation in response to PDGF treatment; when associated with D-115, D-116, D-123, D-127, D-130, D-137, D-138, D-139, D-145, D-148, D-152 and D-157. 1 Publication1
Mutagenesisi152K → D: Marked reduction in RAC1-binding, loss of increase in RAC1 activity and of dorsal ruffles formation in response to PDGF treatment; when associated with D-115, D-116, D-123, D-127, D-130, D-137, D-138, D-139, D-145, D-148, D-149 and D-157. 1 Publication1
Mutagenesisi157K → D: Marked reduction in RAC1-binding, loss of increase in RAC1 activity and of dorsal ruffles formation in response to PDGF treatment; when associated with D-115, D-116, D-123, D-127, D-130, D-137, D-138, D-139, D-145, D-148, D-149 and D-152. 1 Publication1

Organism-specific databases

OpenTargetsiENSG00000132613
PharmGKBiPA164723215

Polymorphism and mutation databases

BioMutaiMTSS1L
DMDMi74727332

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003196101 – 747MTSS1-like proteinAdd BLAST747

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei260PhosphothreonineBy similarity1
Modified residuei264PhosphoserineBy similarity1
Modified residuei441PhosphoserineCombined sources1
Modified residuei579PhosphoserineCombined sources1
Modified residuei601PhosphoserineCombined sources1
Modified residuei612PhosphoserineCombined sources1
Modified residuei624PhosphoserineCombined sources1
Modified residuei634PhosphoserineCombined sources1
Modified residuei639PhosphoserineCombined sources1
Modified residuei643PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ765P7
MaxQBiQ765P7
PaxDbiQ765P7
PeptideAtlasiQ765P7
PRIDEiQ765P7
ProteomicsDBi68659
68660 [Q765P7-2]

PTM databases

iPTMnetiQ765P7
PhosphoSitePlusiQ765P7

Expressioni

Gene expression databases

BgeeiENSG00000132613 Expressed in 157 organ(s), highest expression level in cerebellum
ExpressionAtlasiQ765P7 baseline and differential
GenevisibleiQ765P7 HS

Organism-specific databases

HPAiHPA048531
HPA066469

Interactioni

Subunit structurei

Interacts (via IMD domain) with RAC1; this interaction may be important to potentiate PDGF-induced RAC1 activation.1 Publication

GO - Molecular functioni

Protein-protein interaction databases

BioGridi124914, 3 interactors
IntActiQ765P7, 3 interactors
STRINGi9606.ENSP00000341171

Structurei

3D structure databases

ProteinModelPortaliQ765P7
SMRiQ765P7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini1 – 252IMDPROSITE-ProRule annotationAdd BLAST252
Domaini719 – 736WH2Add BLAST18

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili135 – 159Sequence analysisAdd BLAST25

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi252 – 383Ser-richAdd BLAST132

Sequence similaritiesi

Belongs to the MTSS1 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IGVU Eukaryota
ENOG410XRT4 LUCA
GeneTreeiENSGT00390000002637
HOGENOMiHOG000113691
HOVERGENiHBG052530
InParanoidiQ765P7
KOiK20128
OMAiPHEQPSG
OrthoDBiEOG091G083M
PhylomeDBiQ765P7
TreeFamiTF320619

Family and domain databases

Gene3Di1.20.1270.60, 1 hit
InterProiView protein in InterPro
IPR030059 ABBA
IPR027267 AH/BAR_dom_sf
IPR013606 I-BAR_dom
IPR030127 MIM/ABBA
PANTHERiPTHR15708 PTHR15708, 1 hit
PTHR15708:SF8 PTHR15708:SF8, 1 hit
PfamiView protein in Pfam
PF08397 IMD, 1 hit
SUPFAMiSSF103657 SSF103657, 1 hit
PROSITEiView protein in PROSITE
PS51338 IMD, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q765P7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
METAEKECGA LGGLFQAIVN DMKSSYPIWE DFNSKATKLH SQLRTTVLAA
60 70 80 90 100
VAFLDAFQKV ADMATNTRGA TRDIGSALTR MCMRHRSIET KLRQFTNALL
110 120 130 140 150
ESLINPLQER IEDWKKAANQ LDKDHAKEYK RARHEIKKKS SDTLKLQKKA
160 170 180 190 200
RKELLGKGDL QPQLDSALQD VNDMYLLLEE TEKQAVRRAL IEERGRFCTF
210 220 230 240 250
ITFLQPVVNG ELTMLGEITH LQGIIDDLVV LTAEPHKLPP ASEQVIKDLK
260 270 280 290 300
GSDYSWSYQT PPSSPSSSSS RKSSMCSAPS SSSSAKGGGA PWPGGAQTYS
310 320 330 340 350
PSSTCRYRSL AQPATTTARL SSVSSHDSGF VSQDATYSKP PSPMPSDITS
360 370 380 390 400
QKSSSSASSE ASETCQSVSE CSSPTSDWSK VGSHEQPSGA TLQRRKDRVE
410 420 430 440 450
LLRDTEPGPA SGGTLGPSGE EAPRPRMSPA TIAAKHGEEV SPAASDLAMV
460 470 480 490 500
LTRGLSLEHQ KSSRDSLQYS SGYSTQTTTP SCSEDTIPSQ GSDYDCYSVN
510 520 530 540 550
GDADSEGPPE FDKSSTIPRN SNIAQNYRRL IQTKRPASTA GLPTAGLPTA
560 570 580 590 600
TGLPSGAPPG VATIRRTPST KPTVRRALSS AGPIPIRPPI VPVKTPTVPD
610 620 630 640 650
SPGYMGPTRA GSEECVFYTD ETASPLAPDL AKASPKRLSL PNTAWGSPSP
660 670 680 690 700
EAAGYPGAGA EDEQQQLAAN RHSLVEKLGE LVAGAHALGE GQFPFPTALS
710 720 730 740
ATPTEETPTP PPAATSDPPA EDMLVAIRRG VRLRRTVTND RSAPRIL
Length:747
Mass (Da):79,929
Last modified:July 5, 2004 - v1
Checksum:i9D0EEF31702E9736
GO
Isoform 2 (identifier: Q765P7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     153-155: Missing.
     264-294: SPSSSSSRKSSMCSAPSSSSSAKGGGAPWPG → VPSEPFVSFLSVRFWKNSPLLPAPSTPSSPI
     295-747: Missing.

Note: No experimental confirmation available.
Show »
Length:291
Mass (Da):32,799
Checksum:iCF46678FF8C4A83D
GO

Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
I3L2G4I3L2G4_HUMAN
MTSS1-like protein
MTSS1L
173Annotation score:
A0A087WXN9A0A087WXN9_HUMAN
MTSS1-like protein
MTSS1L
746Annotation score:
H3BPV0H3BPV0_HUMAN
MTSS1-like protein
MTSS1L
136Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_031513153 – 155Missing in isoform 2. 1 Publication3
Alternative sequenceiVSP_031514264 – 294SPSSS…APWPG → VPSEPFVSFLSVRFWKNSPL LPAPSTPSSPI in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_031515295 – 747Missing in isoform 2. 1 PublicationAdd BLAST453

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB115770 mRNA Translation: BAC98378.1
AC020763 Genomic DNA No translation available.
BC002770 mRNA Translation: AAH02770.1
CCDSiCCDS32476.1 [Q765P7-1]
RefSeqiNP_612392.1, NM_138383.2 [Q765P7-1]
UniGeneiHs.432387

Genome annotation databases

EnsembliENST00000338779; ENSP00000341171; ENSG00000132613 [Q765P7-1]
GeneIDi92154
KEGGihsa:92154
UCSCiuc002ezj.4 human [Q765P7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB115770 mRNA Translation: BAC98378.1
AC020763 Genomic DNA No translation available.
BC002770 mRNA Translation: AAH02770.1
CCDSiCCDS32476.1 [Q765P7-1]
RefSeqiNP_612392.1, NM_138383.2 [Q765P7-1]
UniGeneiHs.432387

3D structure databases

ProteinModelPortaliQ765P7
SMRiQ765P7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124914, 3 interactors
IntActiQ765P7, 3 interactors
STRINGi9606.ENSP00000341171

PTM databases

iPTMnetiQ765P7
PhosphoSitePlusiQ765P7

Polymorphism and mutation databases

BioMutaiMTSS1L
DMDMi74727332

Proteomic databases

EPDiQ765P7
MaxQBiQ765P7
PaxDbiQ765P7
PeptideAtlasiQ765P7
PRIDEiQ765P7
ProteomicsDBi68659
68660 [Q765P7-2]

Protocols and materials databases

DNASUi92154
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000338779; ENSP00000341171; ENSG00000132613 [Q765P7-1]
GeneIDi92154
KEGGihsa:92154
UCSCiuc002ezj.4 human [Q765P7-1]

Organism-specific databases

CTDi92154
EuPathDBiHostDB:ENSG00000132613.14
GeneCardsiMTSS1L
HGNCiHGNC:25094 MTSS1L
HPAiHPA048531
HPA066469
MIMi616951 gene
neXtProtiNX_Q765P7
OpenTargetsiENSG00000132613
PharmGKBiPA164723215
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IGVU Eukaryota
ENOG410XRT4 LUCA
GeneTreeiENSGT00390000002637
HOGENOMiHOG000113691
HOVERGENiHBG052530
InParanoidiQ765P7
KOiK20128
OMAiPHEQPSG
OrthoDBiEOG091G083M
PhylomeDBiQ765P7
TreeFamiTF320619

Miscellaneous databases

ChiTaRSiMTSS1L human
GenomeRNAii92154
PROiPR:Q765P7
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000132613 Expressed in 157 organ(s), highest expression level in cerebellum
ExpressionAtlasiQ765P7 baseline and differential
GenevisibleiQ765P7 HS

Family and domain databases

Gene3Di1.20.1270.60, 1 hit
InterProiView protein in InterPro
IPR030059 ABBA
IPR027267 AH/BAR_dom_sf
IPR013606 I-BAR_dom
IPR030127 MIM/ABBA
PANTHERiPTHR15708 PTHR15708, 1 hit
PTHR15708:SF8 PTHR15708:SF8, 1 hit
PfamiView protein in Pfam
PF08397 IMD, 1 hit
SUPFAMiSSF103657 SSF103657, 1 hit
PROSITEiView protein in PROSITE
PS51338 IMD, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiMTSSL_HUMAN
AccessioniPrimary (citable) accession number: Q765P7
Secondary accession number(s): A6NJI7, Q9BUA8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: July 5, 2004
Last modified: November 7, 2018
This is version 108 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again