Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 115 (18 Sep 2019)
Sequence version 1 (05 Jul 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Protein MTSS 2

Gene

MTSS2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in plasma membrane dynamics. Potentiated PDGF-mediated formation of membrane ruffles and lamellipodia in fibroblasts, acting via RAC1 activation (PubMed:14752106). May function in actin bundling (PubMed:14752106).1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActin-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein MTSS 2Curated
Alternative name(s):
Actin-bundling with BAIAP2 homology protein 1
Short name:
ABBA-1
MTSS1-like protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MTSS2Imported
Synonyms:MTSS1LImported
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 16

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25094 MTSS2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
616951 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q765P7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell projection, Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi115K → D: Marked reduction in RAC1-binding, loss of increase in RAC1 activity and of dorsal ruffles formation in response to PDGF treatment; when associated with D-116, D-123, D-127, D-130, D-137, D-138, D-139, D-145, D-148, D-149, D-152 and D-157. 1 Publication1
Mutagenesisi116K → D: Marked reduction in RAC1-binding, loss of increase in RAC1 activity and of dorsal ruffles formation in response to PDGF treatment; when associated with D-115, D-123, D-127, D-130, D-137, D-138, D-139, D-145, D-148, D-149, D-152 and D-157. 1 Publication1
Mutagenesisi123K → D: Marked reduction in RAC1-binding, loss of increase in RAC1 activity and of dorsal ruffles formation in response to PDGF treatment; when associated with D-115, D-116, D-127, D-130, D-137, D-138, D-139, D-145, D-148, D-149, D-152 and D-157. 1 Publication1
Mutagenesisi127K → D: Marked reduction in RAC1-binding, loss of increase in RAC1 activity and of dorsal ruffles formation in response to PDGF treatment; when associated with D-115, D-116, D-123, D-130, D-137, D-138, D-139, D-145, D-148, D-149, D-152 and D-157. 1 Publication1
Mutagenesisi130K → D: Marked reduction in RAC1-binding, loss of increase in RAC1 activity and of dorsal ruffles formation in response to PDGF treatment; when associated with D-115, D-116, D-123, D-127, D-137, D-138, D-139, D-145, D-148, D-149, D-152 and D-157. 1 Publication1
Mutagenesisi137K → D: Marked reduction in RAC1-binding, loss of increase in RAC1 activity and of dorsal ruffles formation in response to PDGF treatment; when associated with D-115, D-116, D-123, D-127, D-130, D-138, D-139, D-145, D-148, D-149, D-152 and D-157. 1 Publication1
Mutagenesisi138K → D: Marked reduction in RAC1-binding, loss of increase in RAC1 activity and of dorsal ruffles formation in response to PDGF treatment; when associated with D-115, D-116, D-123, D-127, D-130, D-137, D-139, D-145, D-148, D-149, D-152 and D-157. 1 Publication1
Mutagenesisi139K → D: Marked reduction in RAC1-binding, loss of increase in RAC1 activity and of dorsal ruffles formation in response to PDGF treatment; when associated with D-115, D-116, D-123, D-127, D-130, D-137, D-138, D-145, D-148, D-149, D-152 and D-157. 1 Publication1
Mutagenesisi145K → D: Marked reduction in RAC1-binding, loss of increase in RAC1 activity and of dorsal ruffles formation in response to PDGF treatment; when associated with D-115, D-116, D-123, D-127, D-130, D-137, D-138, D-139, D-148, D-149, D-152 and D-157. 1 Publication1
Mutagenesisi148K → D: Marked reduction in RAC1-binding, loss of increase in RAC1 activity and of dorsal ruffles formation in response to PDGF treatment; when associated with D-115, D-116, D-123, D-127, D-130, D-137, D-138, D-139, D-145, D-149, D-152 and D-157. 1 Publication1
Mutagenesisi149K → D: Marked reduction in RAC1-binding, loss of increase in RAC1 activity and of dorsal ruffles formation in response to PDGF treatment; when associated with D-115, D-116, D-123, D-127, D-130, D-137, D-138, D-139, D-145, D-148, D-152 and D-157. 1 Publication1
Mutagenesisi152K → D: Marked reduction in RAC1-binding, loss of increase in RAC1 activity and of dorsal ruffles formation in response to PDGF treatment; when associated with D-115, D-116, D-123, D-127, D-130, D-137, D-138, D-139, D-145, D-148, D-149 and D-157. 1 Publication1
Mutagenesisi157K → D: Marked reduction in RAC1-binding, loss of increase in RAC1 activity and of dorsal ruffles formation in response to PDGF treatment; when associated with D-115, D-116, D-123, D-127, D-130, D-137, D-138, D-139, D-145, D-148, D-149 and D-152. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
92154

Open Targets

More...
OpenTargetsi
ENSG00000132613

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA164723215

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
MTSS1L

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74727332

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003196101 – 747Protein MTSS 2Add BLAST747

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei260PhosphothreonineBy similarity1
Modified residuei264PhosphoserineBy similarity1
Modified residuei441PhosphoserineCombined sources1
Modified residuei579PhosphoserineCombined sources1
Modified residuei601PhosphoserineCombined sources1
Modified residuei612PhosphoserineCombined sources1
Modified residuei624PhosphoserineCombined sources1
Modified residuei634PhosphoserineCombined sources1
Modified residuei639PhosphoserineCombined sources1
Modified residuei643PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q765P7

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q765P7

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q765P7

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q765P7

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q765P7

PeptideAtlas

More...
PeptideAtlasi
Q765P7

PRoteomics IDEntifications database

More...
PRIDEi
Q765P7

ProteomicsDB human proteome resource

More...
ProteomicsDBi
68659 [Q765P7-1]
68660 [Q765P7-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q765P7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q765P7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000132613 Expressed in 157 organ(s), highest expression level in cerebellum

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q765P7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q765P7 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA048531
HPA066469

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via IMD domain) with RAC1; this interaction may be important to potentiate PDGF-induced RAC1 activation.

1 Publication

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
124914, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q765P7, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000341171

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q765P7

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 252IMDPROSITE-ProRule annotationAdd BLAST252
Domaini719 – 736WH2Add BLAST18

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili135 – 159Sequence analysisAdd BLAST25

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi252 – 383Ser-richAdd BLAST132

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MTSS family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IGVU Eukaryota
ENOG410XRT4 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000183156

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000113691

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q765P7

KEGG Orthology (KO)

More...
KOi
K20128

Identification of Orthologs from Complete Genome Data

More...
OMAi
WSKAGQY

Database of Orthologous Groups

More...
OrthoDBi
529252at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q765P7

TreeFam database of animal gene trees

More...
TreeFami
TF320619

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.1270.60, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR027267 AH/BAR_dom_sf
IPR013606 I-BAR_dom
IPR030127 MTSS1/MTSS2
IPR030059 MTSS2

The PANTHER Classification System

More...
PANTHERi
PTHR15708 PTHR15708, 1 hit
PTHR15708:SF8 PTHR15708:SF8, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF08397 IMD, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF103657 SSF103657, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51338 IMD, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q765P7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
METAEKECGA LGGLFQAIVN DMKSSYPIWE DFNSKATKLH SQLRTTVLAA
60 70 80 90 100
VAFLDAFQKV ADMATNTRGA TRDIGSALTR MCMRHRSIET KLRQFTNALL
110 120 130 140 150
ESLINPLQER IEDWKKAANQ LDKDHAKEYK RARHEIKKKS SDTLKLQKKA
160 170 180 190 200
RKELLGKGDL QPQLDSALQD VNDMYLLLEE TEKQAVRRAL IEERGRFCTF
210 220 230 240 250
ITFLQPVVNG ELTMLGEITH LQGIIDDLVV LTAEPHKLPP ASEQVIKDLK
260 270 280 290 300
GSDYSWSYQT PPSSPSSSSS RKSSMCSAPS SSSSAKGGGA PWPGGAQTYS
310 320 330 340 350
PSSTCRYRSL AQPATTTARL SSVSSHDSGF VSQDATYSKP PSPMPSDITS
360 370 380 390 400
QKSSSSASSE ASETCQSVSE CSSPTSDWSK VGSHEQPSGA TLQRRKDRVE
410 420 430 440 450
LLRDTEPGPA SGGTLGPSGE EAPRPRMSPA TIAAKHGEEV SPAASDLAMV
460 470 480 490 500
LTRGLSLEHQ KSSRDSLQYS SGYSTQTTTP SCSEDTIPSQ GSDYDCYSVN
510 520 530 540 550
GDADSEGPPE FDKSSTIPRN SNIAQNYRRL IQTKRPASTA GLPTAGLPTA
560 570 580 590 600
TGLPSGAPPG VATIRRTPST KPTVRRALSS AGPIPIRPPI VPVKTPTVPD
610 620 630 640 650
SPGYMGPTRA GSEECVFYTD ETASPLAPDL AKASPKRLSL PNTAWGSPSP
660 670 680 690 700
EAAGYPGAGA EDEQQQLAAN RHSLVEKLGE LVAGAHALGE GQFPFPTALS
710 720 730 740
ATPTEETPTP PPAATSDPPA EDMLVAIRRG VRLRRTVTND RSAPRIL
Length:747
Mass (Da):79,929
Last modified:July 5, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9D0EEF31702E9736
GO
Isoform 2 (identifier: Q765P7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     153-155: Missing.
     264-294: SPSSSSSRKSSMCSAPSSSSSAKGGGAPWPG → VPSEPFVSFLSVRFWKNSPLLPAPSTPSSPI
     295-747: Missing.

Note: No experimental confirmation available.
Show »
Length:291
Mass (Da):32,799
Checksum:iCF46678FF8C4A83D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WXN9A0A087WXN9_HUMAN
Protein MTSS 2
MTSS2
746Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BPV0H3BPV0_HUMAN
Protein MTSS 2
MTSS2
136Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
I3L2G4I3L2G4_HUMAN
Protein MTSS 2
MTSS2
173Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_031513153 – 155Missing in isoform 2. 1 Publication3
Alternative sequenceiVSP_031514264 – 294SPSSS…APWPG → VPSEPFVSFLSVRFWKNSPL LPAPSTPSSPI in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_031515295 – 747Missing in isoform 2. 1 PublicationAdd BLAST453

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB115770 mRNA Translation: BAC98378.1
AC020763 Genomic DNA No translation available.
BC002770 mRNA Translation: AAH02770.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS32476.1 [Q765P7-1]

NCBI Reference Sequences

More...
RefSeqi
NP_612392.1, NM_138383.2 [Q765P7-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000338779; ENSP00000341171; ENSG00000132613 [Q765P7-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
92154

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:92154

UCSC genome browser

More...
UCSCi
uc002ezj.4 human [Q765P7-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB115770 mRNA Translation: BAC98378.1
AC020763 Genomic DNA No translation available.
BC002770 mRNA Translation: AAH02770.1
CCDSiCCDS32476.1 [Q765P7-1]
RefSeqiNP_612392.1, NM_138383.2 [Q765P7-1]

3D structure databases

SMRiQ765P7
ModBaseiSearch...

Protein-protein interaction databases

BioGridi124914, 3 interactors
IntActiQ765P7, 3 interactors
STRINGi9606.ENSP00000341171

PTM databases

iPTMnetiQ765P7
PhosphoSitePlusiQ765P7

Polymorphism and mutation databases

BioMutaiMTSS1L
DMDMi74727332

Proteomic databases

EPDiQ765P7
jPOSTiQ765P7
MassIVEiQ765P7
MaxQBiQ765P7
PaxDbiQ765P7
PeptideAtlasiQ765P7
PRIDEiQ765P7
ProteomicsDBi68659 [Q765P7-1]
68660 [Q765P7-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
92154
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000338779; ENSP00000341171; ENSG00000132613 [Q765P7-1]
GeneIDi92154
KEGGihsa:92154
UCSCiuc002ezj.4 human [Q765P7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
92154
DisGeNETi92154

GeneCards: human genes, protein and diseases

More...
GeneCardsi
MTSS2
HGNCiHGNC:25094 MTSS2
HPAiHPA048531
HPA066469
MIMi616951 gene
neXtProtiNX_Q765P7
OpenTargetsiENSG00000132613
PharmGKBiPA164723215

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IGVU Eukaryota
ENOG410XRT4 LUCA
GeneTreeiENSGT00950000183156
HOGENOMiHOG000113691
InParanoidiQ765P7
KOiK20128
OMAiWSKAGQY
OrthoDBi529252at2759
PhylomeDBiQ765P7
TreeFamiTF320619

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
MTSS1L human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
92154

Pharos

More...
Pharosi
Q765P7

Protein Ontology

More...
PROi
PR:Q765P7

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000132613 Expressed in 157 organ(s), highest expression level in cerebellum
ExpressionAtlasiQ765P7 baseline and differential
GenevisibleiQ765P7 HS

Family and domain databases

Gene3Di1.20.1270.60, 1 hit
InterProiView protein in InterPro
IPR027267 AH/BAR_dom_sf
IPR013606 I-BAR_dom
IPR030127 MTSS1/MTSS2
IPR030059 MTSS2
PANTHERiPTHR15708 PTHR15708, 1 hit
PTHR15708:SF8 PTHR15708:SF8, 1 hit
PfamiView protein in Pfam
PF08397 IMD, 1 hit
SUPFAMiSSF103657 SSF103657, 1 hit
PROSITEiView protein in PROSITE
PS51338 IMD, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMTSS2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q765P7
Secondary accession number(s): A6NJI7, Q9BUA8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: July 5, 2004
Last modified: September 18, 2019
This is version 115 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again