Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein ZNF767

Gene

ZNF767P

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Protein uncertaini

Functioni

Caution

Could be the product of a pseudogene. Despite its name, it does not contain a canonical C2H2-type zinc-finger and in contrast to other members of the krueppel C2H2-type zinc-finger protein family, it is much shorter and lacks the C-terminus part.Curated

Enzyme and pathway databases

ReactomeiR-HSA-212436 Generic Transcription Pathway

Names & Taxonomyi

Protein namesi
Recommended name:
Protein ZNF767
Alternative name(s):
Zinc finger protein 767 pseudogene
Gene namesi
Name:ZNF767P
Synonyms:ZNF767
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Unplaced

Organism-specific databases

HGNCiHGNC:21884 ZNF767P
neXtProtiNX_Q75MW2

Pathology & Biotechi

Organism-specific databases

DisGeNETi79970

Polymorphism and mutation databases

DMDMi74712880

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002804561 – 155Protein ZNF767Add BLAST155

Proteomic databases

EPDiQ75MW2
PeptideAtlasiQ75MW2
PRIDEiQ75MW2
ProteomicsDBi68639
68640 [Q75MW2-2]

PTM databases

iPTMnetiQ75MW2
PhosphoSitePlusiQ75MW2

Expressioni

Gene expression databases

CleanExiHS_ZNF767

Interactioni

Protein-protein interaction databases

IntActiQ75MW2, 8 interactors

Structurei

3D structure databases

ProteinModelPortaliQ75MW2
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili16 – 92Sequence analysisAdd BLAST77

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
ENOG41112U5 LUCA
InParanoidiQ75MW2
PhylomeDBiQ75MW2

Family and domain databases

InterProiView protein in InterPro
IPR022137 DUF3669_Znf
PfamiView protein in Pfam
PF12417 DUF3669, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q75MW2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEEAAAAPIS PWTMAATIQA MERKIESQAA HLLSLEGQTG MAEKKLADCE
60 70 80 90 100
KTAVEFGNQL EGKWAVLGTL LQEYGLLQRR LENVENLLHN RNFWILRLPP
110 120 130 140 150
GSKGESPKTT PSPSPRSSPR LNKGRSPATG AALTPRFQMF LWTPVQMQKL

RPSRD
Length:155
Mass (Da):17,236
Last modified:July 5, 2004 - v1
Checksum:i217B194F114B23CD
GO
Isoform 2 (identifier: Q75MW2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     109-155: TTPSPSPRSSPRLNKGRSPATGAALTPRFQMFLWTPVQMQKLRPSRD → VPMTFDDVAV

Note: No experimental confirmation available.
Show »
Length:118
Mass (Da):13,077
Checksum:i1FB912D663D3200A
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti5A → V in AAH47675 (PubMed:15489334).Curated1
Sequence conflicti89H → R in AAH47675 (PubMed:15489334).Curated1
Sequence conflicti93F → L in BAB14233 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05703431H → R. Corresponds to variant dbSNP:rs1723718Ensembl.1
Natural variantiVAR_05703538Q → R. Corresponds to variant dbSNP:rs1723719Ensembl.1
Natural variantiVAR_057036131A → T. Corresponds to variant dbSNP:rs1808231Ensembl.1
Natural variantiVAR_057037134T → A. Corresponds to variant dbSNP:rs354055Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_023681109 – 155TTPSP…RPSRD → VPMTFDDVAV in isoform 2. 1 PublicationAdd BLAST47

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK022762 mRNA Translation: BAB14233.1
AC004932 Genomic DNA Translation: AAQ96876.1
CH471146 Genomic DNA Translation: EAW80038.1
CH471146 Genomic DNA Translation: EAW80039.1
BC047675 mRNA Translation: AAH47675.1
UniGeneiHs.520785

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK022762 mRNA Translation: BAB14233.1
AC004932 Genomic DNA Translation: AAQ96876.1
CH471146 Genomic DNA Translation: EAW80038.1
CH471146 Genomic DNA Translation: EAW80039.1
BC047675 mRNA Translation: AAH47675.1
UniGeneiHs.520785

3D structure databases

ProteinModelPortaliQ75MW2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ75MW2, 8 interactors

PTM databases

iPTMnetiQ75MW2
PhosphoSitePlusiQ75MW2

Polymorphism and mutation databases

DMDMi74712880

Proteomic databases

EPDiQ75MW2
PeptideAtlasiQ75MW2
PRIDEiQ75MW2
ProteomicsDBi68639
68640 [Q75MW2-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Organism-specific databases

DisGeNETi79970
GeneCardsiZNF767P
HGNCiHGNC:21884 ZNF767P
neXtProtiNX_Q75MW2
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721 Eukaryota
ENOG41112U5 LUCA
InParanoidiQ75MW2
PhylomeDBiQ75MW2

Enzyme and pathway databases

ReactomeiR-HSA-212436 Generic Transcription Pathway

Miscellaneous databases

ChiTaRSiZNF767P human
PROiPR:Q75MW2

Gene expression databases

CleanExiHS_ZNF767

Family and domain databases

InterProiView protein in InterPro
IPR022137 DUF3669_Znf
PfamiView protein in Pfam
PF12417 DUF3669, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiZN767_HUMAN
AccessioniPrimary (citable) accession number: Q75MW2
Secondary accession number(s): D3DWG6, Q86WY4, Q9H9J3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 20, 2007
Last sequence update: July 5, 2004
Last modified: June 20, 2018
This is version 81 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again