Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q70Z44 (5HT3D_HUMAN)

Entry version 149 (02 Dec 2020)
Sequence version 3 (28 Jun 2011)
Previous versions | rss
Add a publicationFeedback
Protein

5-hydroxytryptamine receptor 3D

Gene

HTR3D

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor is a ligand-gated ion channel, which when activated causes fast, depolarizing responses. It is a cation-specific, but otherwise relatively nonselective, ion channel.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIon channel, Ligand-gated ion channel, Receptor
Biological processIon transport, Transport

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q70Z44

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-112314, Neurotransmitter receptors and postsynaptic signal transmission

Protein family/group databases

Transport Classification Database

More...TCDBi		1.A.9.2.3, the neurotransmitter receptor, cys loop, ligand-gated ion channel (lic) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
5-hydroxytryptamine receptor 3D
Short name:
5-HT3-D
Short name:
5-HT3D
Alternative name(s):
Serotonin receptor 3D
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:HTR3D
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000186090.10

Human Gene Nomenclature Database

More...HGNCi		HGNC:24004, HTR3D

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		610122, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q70Z44

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini25 – 232ExtracellularSequence analysisAdd BLAST208
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei233 – 253Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini254 – 264CytoplasmicSequence analysisAdd BLAST11
Transmembranei265 – 285Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini286 – 306ExtracellularSequence analysisAdd BLAST21
Transmembranei307 – 327Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini328 – 431CytoplasmicSequence analysisAdd BLAST104
Transmembranei432 – 452Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini453 – 454ExtracellularSequence analysis2

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		200909

Open Targets

More...OpenTargetsi		ENSG00000186090

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134866755

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q70Z44, Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL2094132

Drug and drug target database

More...DrugBanki		DB01239, Chlorprothixene
DB11273, Dihydroergocornine
DB13345, Dihydroergocristine
DB01049, Ergoloid mesylate
DB00898, Ethanol
DB12141, Gilteritinib
DB00715, Paroxetine
DB09304, Setiptiline
DB13025, Tiapride
DB00246, Ziprasidone

DrugCentral

More...DrugCentrali		Q70Z44

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		HTR3D

Domain mapping of disease mutations (DMDM)

More...DMDMi		338817899

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 24Sequence analysisAdd BLAST24
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000031229325 – 4545-hydroxytryptamine receptor 3DAdd BLAST430

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi66N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q70Z44

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q70Z44

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q70Z44

PeptideAtlas

More...PeptideAtlasi		Q70Z44

PRoteomics IDEntifications database

More...PRIDEi		Q70Z44

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		68580 [Q70Z44-1]
68581 [Q70Z44-2]
68582 [Q70Z44-3]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q70Z44, 1 site

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q70Z44

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q70Z44

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in liver, as well as fetal and adult colon and kidney.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000186090, Expressed in blood and 1 other tissue

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q70Z44, baseline and differential

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000186090, Not detected

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Forms a pentaheteromeric complex with HTR3A. Not functional as a homomeric complex.

1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		128355, 5 interactors

ComplexPortal: manually curated resource of macromolecular complexes

More...ComplexPortali		CPX-272, 5-hydroxytryptamine-3A/D receptor complex

Protein interaction database and analysis system

More...IntActi		Q70Z44, 4 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000371929

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q70Z44

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q70Z44, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the ligand-gated ion channel (TC 1.A.9) family. 5-hydroxytryptamine receptor (TC 1.A.9.2) subfamily. HTR3D sub-subfamily. [View classification]Curated

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3645, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000156739

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_018074_5_2_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q70Z44

Identification of Orthologs from Complete Genome Data

More...OMAi		MRVVSIC

Database of Orthologous Groups

More...OrthoDBi		123230at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q70Z44

TreeFam database of animal gene trees

More...TreeFami		TF315605

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.70.170.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR006202, Neur_chan_lig-bd
IPR036734, Neur_chan_lig-bd_sf
IPR006201, Neur_channel
IPR036719, Neuro-gated_channel_TM_sf
IPR006029, Neurotrans-gated_channel_TM

The PANTHER Classification System

More...PANTHERi		PTHR18945, PTHR18945, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF02931, Neur_chan_LBD, 1 hit
PF02932, Neur_chan_memb, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF63712, SSF63712, 1 hit
SSF90112, SSF90112, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q70Z44-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQKHSPGPPA LALLSQSLLT TGNGDTLIIN CPGFGQHRVD PAAFQAVFDR 
        60         70         80         90        100
KAIGPVTNYS VATHVNISFT LSAIWNCYSR IHTFNCHHAR PWHNQFVQWN 
       110        120        130        140        150
PDECGGIKKS GMATENLWLS DVFIEESVDQ TPAGLMASMS IVKATSNTIS 
       160        170        180        190        200
QCGWSASANW TPSISPSMDR ARAWRRMSRS FQIHHRTSFR TRREWVLLGI 
       210        220        230        240        250
QKRTIKVTVA TNQYEQAIFH VAIRRRCRPS PYVVNFLVPS GILIAIDALS 
       260        270        280        290        300
FYLPLESGNC APFKMTVLLG YSVFLLMMND LLPATSTSSH ASLVAPLALM 
       310        320        330        340        350
QTPLPAGVYF ALCLSLMVGS LLETIFITHL LHVATTQPLP LPRWLHSLLL 
       360        370        380        390        400
HCTGQGRCCP TAPQKGNKGP GLTPTHLPGV KEPEVSAGQM PGPGEAELTG 
       410        420        430        440        450
GSEWTRAQRE HEAQKQHSVE LWVQFSHAMD ALLFRLYLLF MASSIITVIC 

LWNT
Length:454
Mass (Da):50,191
Last modified:June 28, 2011 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8B12F6CC31C4446C
GO
Isoform 2 (identifier: Q70Z44-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-135: Missing.
     172-220: RAWRRMSRSFQIHHRTSFRTRREWVLLGIQKRTIKVTVATNQYEQAIFH → ERSPSALSPTQ
     295-306: APLALMQTPLPA → RPHPSRDQKR

Show »
Length:279
Mass (Da):30,477
Checksum:i6B896347F37E902A
GO
Isoform 3 (identifier: Q70Z44-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-219: Missing.
     220-220: H → M
     295-306: APLALMQTPLPA → RPHPSRDQKR

Show »
Length:233
Mass (Da):25,697
Checksum:iCFAF7256BA7195EE
GO
Isoform 4 (identifier: Q70Z44-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-37: MQKHSPGPPALALLSQSLLTTGNGDTLIINCPGFGQH → MERGWFHGKGFLLGFILHLLLQDSHLQLVTSFLWLNM
     38-98: Missing.
     171-171: A → GERSPSALSPTQVT
     295-306: APLALMQTPLPA → RPHPSRDQKR

Show »
Length:404
Mass (Da):45,145
Checksum:i6EE0A9AE03DF8694
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F6WC43F6WC43_HUMAN
5-hydroxytryptamine receptor 3D
HTR3D
279Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti155S → P in AAI01092 (PubMed:15489334).Curated1
Sequence conflicti368K → R in AAO38166 (PubMed:17392525).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_037478171A → G1 PublicationCorresponds to variant dbSNP:rs6443930Ensembl.1
Natural variantiVAR_037479225R → H1 PublicationCorresponds to variant dbSNP:rs1000952Ensembl.1
Natural variantiVAR_037480435R → H1 PublicationCorresponds to variant dbSNP:rs6789754Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0297971 – 219Missing in isoform 3. 1 PublicationAdd BLAST219
Alternative sequenceiVSP_0297981 – 135Missing in isoform 2. 2 PublicationsAdd BLAST135
Alternative sequenceiVSP_0448281 – 37MQKHS…GFGQH → MERGWFHGKGFLLGFILHLL LQDSHLQLVTSFLWLNM in isoform 4. CuratedAdd BLAST37
Alternative sequenceiVSP_04482938 – 98Missing in isoform 4. CuratedAdd BLAST61
Alternative sequenceiVSP_044830171A → GERSPSALSPTQVT in isoform 4. Curated1
Alternative sequenceiVSP_029799172 – 220RAWRR…QAIFH → ERSPSALSPTQ in isoform 2. 2 PublicationsAdd BLAST49
Alternative sequenceiVSP_029800220H → M in isoform 3. 1 Publication1
Alternative sequenceiVSP_029801295 – 306APLAL…TPLPA → RPHPSRDQKR in isoform 2, isoform 3 and isoform 4. 2 PublicationsAdd BLAST12

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AJ437318 mRNA Translation: CAD24817.1
AY159812 mRNA Translation: AAO38166.2
AC068644 Genomic DNA No translation available.
AC131235 Genomic DNA No translation available.
BC101090 mRNA Translation: AAI01091.1
BC101091 mRNA Translation: AAI01092.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS3249.1 [Q70Z44-2]
CCDS46966.1 [Q70Z44-4]
CCDS54685.1 [Q70Z44-1]

NCBI Reference Sequences

More...RefSeqi		NP_001138615.1, NM_001145143.1 [Q70Z44-4]
NP_001157118.1, NM_001163646.1 [Q70Z44-1]
NP_872343.2, NM_182537.2
XP_016861343.1, XM_017005854.1 [Q70Z44-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000382489; ENSP00000371929; ENSG00000186090 [Q70Z44-1]
ENST00000428798; ENSP00000405409; ENSG00000186090 [Q70Z44-4]
ENST00000453435; ENSP00000389268; ENSG00000186090 [Q70Z44-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		200909

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:200909

UCSC genome browser

More...UCSCi		uc010hxp.4, human [Q70Z44-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ437318 mRNA Translation: CAD24817.1
AY159812 mRNA Translation: AAO38166.2
AC068644 Genomic DNA No translation available.
AC131235 Genomic DNA No translation available.
BC101090 mRNA Translation: AAI01091.1
BC101091 mRNA Translation: AAI01092.1
CCDSiCCDS3249.1 [Q70Z44-2]
CCDS46966.1 [Q70Z44-4]
CCDS54685.1 [Q70Z44-1]
RefSeqiNP_001138615.1, NM_001145143.1 [Q70Z44-4]
NP_001157118.1, NM_001163646.1 [Q70Z44-1]
NP_872343.2, NM_182537.2
XP_016861343.1, XM_017005854.1 [Q70Z44-3]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi128355, 5 interactors
ComplexPortaliCPX-272, 5-hydroxytryptamine-3A/D receptor complex
IntActiQ70Z44, 4 interactors
STRINGi9606.ENSP00000371929

Chemistry databases

BindingDBiQ70Z44
ChEMBLiCHEMBL2094132
DrugBankiDB01239, Chlorprothixene
DB11273, Dihydroergocornine
DB13345, Dihydroergocristine
DB01049, Ergoloid mesylate
DB00898, Ethanol
DB12141, Gilteritinib
DB00715, Paroxetine
DB09304, Setiptiline
DB13025, Tiapride
DB00246, Ziprasidone
DrugCentraliQ70Z44

Protein family/group databases

TCDBi1.A.9.2.3, the neurotransmitter receptor, cys loop, ligand-gated ion channel (lic) family

PTM databases

GlyGeniQ70Z44, 1 site
iPTMnetiQ70Z44
PhosphoSitePlusiQ70Z44

Polymorphism and mutation databases

BioMutaiHTR3D
DMDMi338817899

Proteomic databases

jPOSTiQ70Z44
MassIVEiQ70Z44
PaxDbiQ70Z44
PeptideAtlasiQ70Z44
PRIDEiQ70Z44
ProteomicsDBi68580 [Q70Z44-1]
68581 [Q70Z44-2]
68582 [Q70Z44-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		56799, 45 antibodies

Genome annotation databases

EnsembliENST00000382489; ENSP00000371929; ENSG00000186090 [Q70Z44-1]
ENST00000428798; ENSP00000405409; ENSG00000186090 [Q70Z44-4]
ENST00000453435; ENSP00000389268; ENSG00000186090 [Q70Z44-3]
GeneIDi200909
KEGGihsa:200909
UCSCiuc010hxp.4, human [Q70Z44-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		200909
DisGeNETi200909
EuPathDBiHostDB:ENSG00000186090.10

GeneCards: human genes, protein and diseases

More...GeneCardsi		HTR3D
HGNCiHGNC:24004, HTR3D
HPAiENSG00000186090, Not detected
MIMi610122, gene
neXtProtiNX_Q70Z44
OpenTargetsiENSG00000186090
PharmGKBiPA134866755

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3645, Eukaryota
GeneTreeiENSGT00940000156739
HOGENOMiCLU_018074_5_2_1
InParanoidiQ70Z44
OMAiMRVVSIC
OrthoDBi123230at2759
PhylomeDBiQ70Z44
TreeFamiTF315605

Enzyme and pathway databases

PathwayCommonsiQ70Z44
ReactomeiR-HSA-112314, Neurotransmitter receptors and postsynaptic signal transmission

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		200909, 4 hits in 837 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		HTR3D, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		HTR3D

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		200909
PharosiQ70Z44, Tchem

Protein Ontology

More...PROi		PR:Q70Z44
RNActiQ70Z44, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000186090, Expressed in blood and 1 other tissue
ExpressionAtlasiQ70Z44, baseline and differential

Family and domain databases

Gene3Di2.70.170.10, 1 hit
InterProiView protein in InterPro
IPR006202, Neur_chan_lig-bd
IPR036734, Neur_chan_lig-bd_sf
IPR006201, Neur_channel
IPR036719, Neuro-gated_channel_TM_sf
IPR006029, Neurotrans-gated_channel_TM
PANTHERiPTHR18945, PTHR18945, 1 hit
PfamiView protein in Pfam
PF02931, Neur_chan_LBD, 1 hit
PF02932, Neur_chan_memb, 1 hit
SUPFAMiSSF63712, SSF63712, 1 hit
SSF90112, SSF90112, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry namei5HT3D_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q70Z44
Secondary accession number(s): C9J2I6
, J3QT78, Q495N5, Q495N6, Q7Z6B3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: June 28, 2011
Last modified: December 2, 2020
This is version 149 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. SIMILARITY comments
    Index of protein domains and families
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again