UniProtKB - Q70Z44 (5HT3D_HUMAN)
5-hydroxytryptamine receptor 3D
HTR3D
Functioni
GO - Molecular functioni
- neurotransmitter receptor activity Source: GO_Central
- serotonin-gated cation-selective channel activity Source: CACAO
- transmembrane signaling receptor activity Source: InterPro
GO - Biological processi
- chemical synaptic transmission Source: GO_Central
- ion transmembrane transport Source: GO_Central
- nervous system process Source: GO_Central
- regulation of membrane potential Source: GO_Central
- signal transduction Source: GO_Central
Keywordsi
Molecular function | Ion channel, Ligand-gated ion channel, Receptor |
Biological process | Ion transport, Transport |
Enzyme and pathway databases
PathwayCommonsi | Q70Z44 |
Reactomei | R-HSA-112314, Neurotransmitter receptors and postsynaptic signal transmission |
Protein family/group databases
TCDBi | 1.A.9.2.3, the neurotransmitter receptor, cys loop, ligand-gated ion channel (lic) family |
Names & Taxonomyi
Protein namesi | Recommended name: 5-hydroxytryptamine receptor 3DShort name: 5-HT3-D Short name: 5-HT3D Alternative name(s): Serotonin receptor 3D |
Gene namesi | Name:HTR3D |
Organismi | Homo sapiens (Human) |
Taxonomic identifieri | 9606 [NCBI] |
Taxonomic lineagei | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Proteomesi |
|
Organism-specific databases
EuPathDBi | HostDB:ENSG00000186090.10 |
HGNCi | HGNC:24004, HTR3D |
MIMi | 610122, gene |
neXtProti | NX_Q70Z44 |
Subcellular locationi
Plasma membrane
- Cell membrane 1 Publication; Multi-pass membrane protein 1 Publication
Note: Presumably retained within the endoplasmic reticulum unless complexed with HTR3A.
Plasma Membrane
- integral component of plasma membrane Source: GO_Central
- plasma membrane Source: Reactome
Other locations
- neuron projection Source: GO_Central
- synapse Source: GO_Central
Topology
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Topological domaini | 25 – 232 | ExtracellularSequence analysisAdd BLAST | 208 | |
Transmembranei | 233 – 253 | Helical; Name=1Sequence analysisAdd BLAST | 21 | |
Topological domaini | 254 – 264 | CytoplasmicSequence analysisAdd BLAST | 11 | |
Transmembranei | 265 – 285 | Helical; Name=2Sequence analysisAdd BLAST | 21 | |
Topological domaini | 286 – 306 | ExtracellularSequence analysisAdd BLAST | 21 | |
Transmembranei | 307 – 327 | Helical; Name=3Sequence analysisAdd BLAST | 21 | |
Topological domaini | 328 – 431 | CytoplasmicSequence analysisAdd BLAST | 104 | |
Transmembranei | 432 – 452 | Helical; Name=4Sequence analysisAdd BLAST | 21 | |
Topological domaini | 453 – 454 | ExtracellularSequence analysis | 2 |
Keywords - Cellular componenti
Cell membrane, MembranePathology & Biotechi
Organism-specific databases
DisGeNETi | 200909 |
OpenTargetsi | ENSG00000186090 |
PharmGKBi | PA134866755 |
Miscellaneous databases
Pharosi | Q70Z44, Tchem |
Chemistry databases
ChEMBLi | CHEMBL2094132 |
DrugBanki | DB01239, Chlorprothixene DB11273, Dihydroergocornine DB13345, Dihydroergocristine DB01049, Ergoloid mesylate DB00898, Ethanol DB12141, Gilteritinib DB00715, Paroxetine DB09304, Setiptiline DB13025, Tiapride DB00246, Ziprasidone |
DrugCentrali | Q70Z44 |
Polymorphism and mutation databases
BioMutai | HTR3D |
DMDMi | 338817899 |
PTM / Processingi
Molecule processing
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Signal peptidei | 1 – 24 | Sequence analysisAdd BLAST | 24 | |
ChainiPRO_0000312293 | 25 – 454 | 5-hydroxytryptamine receptor 3DAdd BLAST | 430 |
Amino acid modifications
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Glycosylationi | 66 | N-linked (GlcNAc...) asparagineSequence analysis | 1 |
Keywords - PTMi
GlycoproteinProteomic databases
jPOSTi | Q70Z44 |
MassIVEi | Q70Z44 |
PaxDbi | Q70Z44 |
PeptideAtlasi | Q70Z44 |
PRIDEi | Q70Z44 |
ProteomicsDBi | 68580 [Q70Z44-1] 68581 [Q70Z44-2] 68582 [Q70Z44-3] |
PTM databases
GlyGeni | Q70Z44, 1 site |
iPTMneti | Q70Z44 |
PhosphoSitePlusi | Q70Z44 |
Expressioni
Tissue specificityi
Gene expression databases
Bgeei | ENSG00000186090, Expressed in blood and 1 other tissue |
ExpressionAtlasi | Q70Z44, baseline and differential |
Organism-specific databases
HPAi | ENSG00000186090, Not detected |
Interactioni
Subunit structurei
Forms a pentaheteromeric complex with HTR3A. Not functional as a homomeric complex.
1 PublicationBinary interactionsi
Q70Z44
With | #Exp. | IntAct |
---|---|---|
HTR3A [P46098] | 5 | EBI-9008717,EBI-9008743 |
Protein-protein interaction databases
BioGRIDi | 128355, 5 interactors |
ComplexPortali | CPX-272, 5-hydroxytryptamine-3A/D receptor complex |
IntActi | Q70Z44, 4 interactors |
STRINGi | 9606.ENSP00000371929 |
Chemistry databases
BindingDBi | Q70Z44 |
Miscellaneous databases
RNActi | Q70Z44, protein |
Family & Domainsi
Sequence similaritiesi
Keywords - Domaini
Signal, Transmembrane, Transmembrane helixPhylogenomic databases
eggNOGi | KOG3645, Eukaryota |
GeneTreei | ENSGT00940000156739 |
HOGENOMi | CLU_018074_5_2_1 |
InParanoidi | Q70Z44 |
OMAi | MRVVSIC |
OrthoDBi | 123230at2759 |
PhylomeDBi | Q70Z44 |
TreeFami | TF315605 |
Family and domain databases
Gene3Di | 2.70.170.10, 1 hit |
InterProi | View protein in InterPro IPR006202, Neur_chan_lig-bd IPR036734, Neur_chan_lig-bd_sf IPR006201, Neur_channel IPR036719, Neuro-gated_channel_TM_sf IPR006029, Neurotrans-gated_channel_TM |
PANTHERi | PTHR18945, PTHR18945, 1 hit |
Pfami | View protein in Pfam PF02931, Neur_chan_LBD, 1 hit PF02932, Neur_chan_memb, 1 hit |
SUPFAMi | SSF63712, SSF63712, 1 hit SSF90112, SSF90112, 1 hit |
s (4+)i Sequence
Sequence statusi: Complete.
: The displayed sequence is further processed into a mature form. Sequence processingi
This entry describes 4 produced by isoformsialternative splicing. AlignAdd to basketThis entry has 4 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All
This isoform has been chosen as the sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. canonicali
10 20 30 40 50
MQKHSPGPPA LALLSQSLLT TGNGDTLIIN CPGFGQHRVD PAAFQAVFDR
60 70 80 90 100
KAIGPVTNYS VATHVNISFT LSAIWNCYSR IHTFNCHHAR PWHNQFVQWN
110 120 130 140 150
PDECGGIKKS GMATENLWLS DVFIEESVDQ TPAGLMASMS IVKATSNTIS
160 170 180 190 200
QCGWSASANW TPSISPSMDR ARAWRRMSRS FQIHHRTSFR TRREWVLLGI
210 220 230 240 250
QKRTIKVTVA TNQYEQAIFH VAIRRRCRPS PYVVNFLVPS GILIAIDALS
260 270 280 290 300
FYLPLESGNC APFKMTVLLG YSVFLLMMND LLPATSTSSH ASLVAPLALM
310 320 330 340 350
QTPLPAGVYF ALCLSLMVGS LLETIFITHL LHVATTQPLP LPRWLHSLLL
360 370 380 390 400
HCTGQGRCCP TAPQKGNKGP GLTPTHLPGV KEPEVSAGQM PGPGEAELTG
410 420 430 440 450
GSEWTRAQRE HEAQKQHSVE LWVQFSHAMD ALLFRLYLLF MASSIITVIC
LWNT
The sequence of this isoform differs from the canonical sequence as follows:
1-37: MQKHSPGPPALALLSQSLLTTGNGDTLIINCPGFGQH → MERGWFHGKGFLLGFILHLLLQDSHLQLVTSFLWLNM
38-98: Missing.
171-171: A → GERSPSALSPTQVT
295-306: APLALMQTPLPA → RPHPSRDQKR
Computationally mapped potential isoform sequencesi
There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basketF6WC43 | F6WC43_HUMAN | 5-hydroxytryptamine receptor 3D | HTR3D | 279 | Annotation score: |
Experimental Info
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Sequence conflicti | 155 | S → P in AAI01092 (PubMed:15489334).Curated | 1 | |
Sequence conflicti | 368 | K → R in AAO38166 (PubMed:17392525).Curated | 1 |
Natural variant
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Natural variantiVAR_037478 | 171 | A → G1 PublicationCorresponds to variant dbSNP:rs6443930Ensembl. | 1 | |
Natural variantiVAR_037479 | 225 | R → H1 PublicationCorresponds to variant dbSNP:rs1000952Ensembl. | 1 | |
Natural variantiVAR_037480 | 435 | R → H1 PublicationCorresponds to variant dbSNP:rs6789754Ensembl. | 1 |
Alternative sequence
Feature key | Position(s) | DescriptionActions | Graphical view | Length |
---|---|---|---|---|
Alternative sequenceiVSP_029797 | 1 – 219 | Missing in isoform 3. 1 PublicationAdd BLAST | 219 | |
Alternative sequenceiVSP_029798 | 1 – 135 | Missing in isoform 2. 2 PublicationsAdd BLAST | 135 | |
Alternative sequenceiVSP_044828 | 1 – 37 | MQKHS…GFGQH → MERGWFHGKGFLLGFILHLL LQDSHLQLVTSFLWLNM in isoform 4. CuratedAdd BLAST | 37 | |
Alternative sequenceiVSP_044829 | 38 – 98 | Missing in isoform 4. CuratedAdd BLAST | 61 | |
Alternative sequenceiVSP_044830 | 171 | A → GERSPSALSPTQVT in isoform 4. Curated | 1 | |
Alternative sequenceiVSP_029799 | 172 – 220 | RAWRR…QAIFH → ERSPSALSPTQ in isoform 2. 2 PublicationsAdd BLAST | 49 | |
Alternative sequenceiVSP_029800 | 220 | H → M in isoform 3. 1 Publication | 1 | |
Alternative sequenceiVSP_029801 | 295 – 306 | APLAL…TPLPA → RPHPSRDQKR in isoform 2, isoform 3 and isoform 4. 2 PublicationsAdd BLAST | 12 |
Sequence databases
Select the link destinations: EMBLi GenBanki DDBJi Links Updated | AJ437318 mRNA Translation: CAD24817.1 AY159812 mRNA Translation: AAO38166.2 AC068644 Genomic DNA No translation available. AC131235 Genomic DNA No translation available. BC101090 mRNA Translation: AAI01091.1 BC101091 mRNA Translation: AAI01092.1 |
CCDSi | CCDS3249.1 [Q70Z44-2] CCDS46966.1 [Q70Z44-4] CCDS54685.1 [Q70Z44-1] |
RefSeqi | NP_001138615.1, NM_001145143.1 [Q70Z44-4] NP_001157118.1, NM_001163646.1 [Q70Z44-1] NP_872343.2, NM_182537.2 XP_016861343.1, XM_017005854.1 [Q70Z44-3] |
Genome annotation databases
Ensembli | ENST00000382489; ENSP00000371929; ENSG00000186090 [Q70Z44-1] ENST00000428798; ENSP00000405409; ENSG00000186090 [Q70Z44-4] ENST00000453435; ENSP00000389268; ENSG00000186090 [Q70Z44-3] |
GeneIDi | 200909 |
KEGGi | hsa:200909 |
UCSCi | uc010hxp.4, human [Q70Z44-1] |
Keywords - Coding sequence diversityi
Alternative splicing, PolymorphismSimilar proteinsi
Cross-referencesi
Sequence databases
Select the link destinations: EMBLi GenBanki DDBJi Links Updated | AJ437318 mRNA Translation: CAD24817.1 AY159812 mRNA Translation: AAO38166.2 AC068644 Genomic DNA No translation available. AC131235 Genomic DNA No translation available. BC101090 mRNA Translation: AAI01091.1 BC101091 mRNA Translation: AAI01092.1 |
CCDSi | CCDS3249.1 [Q70Z44-2] CCDS46966.1 [Q70Z44-4] CCDS54685.1 [Q70Z44-1] |
RefSeqi | NP_001138615.1, NM_001145143.1 [Q70Z44-4] NP_001157118.1, NM_001163646.1 [Q70Z44-1] NP_872343.2, NM_182537.2 XP_016861343.1, XM_017005854.1 [Q70Z44-3] |
3D structure databases
ModBasei | Search... |
SWISS-MODEL-Workspacei | Submit a new modelling project... |
Protein-protein interaction databases
BioGRIDi | 128355, 5 interactors |
ComplexPortali | CPX-272, 5-hydroxytryptamine-3A/D receptor complex |
IntActi | Q70Z44, 4 interactors |
STRINGi | 9606.ENSP00000371929 |
Chemistry databases
BindingDBi | Q70Z44 |
ChEMBLi | CHEMBL2094132 |
DrugBanki | DB01239, Chlorprothixene DB11273, Dihydroergocornine DB13345, Dihydroergocristine DB01049, Ergoloid mesylate DB00898, Ethanol DB12141, Gilteritinib DB00715, Paroxetine DB09304, Setiptiline DB13025, Tiapride DB00246, Ziprasidone |
DrugCentrali | Q70Z44 |
Protein family/group databases
TCDBi | 1.A.9.2.3, the neurotransmitter receptor, cys loop, ligand-gated ion channel (lic) family |
PTM databases
GlyGeni | Q70Z44, 1 site |
iPTMneti | Q70Z44 |
PhosphoSitePlusi | Q70Z44 |
Polymorphism and mutation databases
BioMutai | HTR3D |
DMDMi | 338817899 |
Proteomic databases
jPOSTi | Q70Z44 |
MassIVEi | Q70Z44 |
PaxDbi | Q70Z44 |
PeptideAtlasi | Q70Z44 |
PRIDEi | Q70Z44 |
ProteomicsDBi | 68580 [Q70Z44-1] 68581 [Q70Z44-2] 68582 [Q70Z44-3] |
Protocols and materials databases
Antibodypediai | 56799, 45 antibodies |
Genome annotation databases
Ensembli | ENST00000382489; ENSP00000371929; ENSG00000186090 [Q70Z44-1] ENST00000428798; ENSP00000405409; ENSG00000186090 [Q70Z44-4] ENST00000453435; ENSP00000389268; ENSG00000186090 [Q70Z44-3] |
GeneIDi | 200909 |
KEGGi | hsa:200909 |
UCSCi | uc010hxp.4, human [Q70Z44-1] |
Organism-specific databases
CTDi | 200909 |
DisGeNETi | 200909 |
EuPathDBi | HostDB:ENSG00000186090.10 |
GeneCardsi | HTR3D |
HGNCi | HGNC:24004, HTR3D |
HPAi | ENSG00000186090, Not detected |
MIMi | 610122, gene |
neXtProti | NX_Q70Z44 |
OpenTargetsi | ENSG00000186090 |
PharmGKBi | PA134866755 |
GenAtlasi | Search... |
Phylogenomic databases
eggNOGi | KOG3645, Eukaryota |
GeneTreei | ENSGT00940000156739 |
HOGENOMi | CLU_018074_5_2_1 |
InParanoidi | Q70Z44 |
OMAi | MRVVSIC |
OrthoDBi | 123230at2759 |
PhylomeDBi | Q70Z44 |
TreeFami | TF315605 |
Enzyme and pathway databases
PathwayCommonsi | Q70Z44 |
Reactomei | R-HSA-112314, Neurotransmitter receptors and postsynaptic signal transmission |
Miscellaneous databases
BioGRID-ORCSi | 200909, 4 hits in 837 CRISPR screens |
ChiTaRSi | HTR3D, human |
GeneWikii | HTR3D |
GenomeRNAii | 200909 |
Pharosi | Q70Z44, Tchem |
PROi | PR:Q70Z44 |
RNActi | Q70Z44, protein |
SOURCEi | Search... |
Gene expression databases
Bgeei | ENSG00000186090, Expressed in blood and 1 other tissue |
ExpressionAtlasi | Q70Z44, baseline and differential |
Family and domain databases
Gene3Di | 2.70.170.10, 1 hit |
InterProi | View protein in InterPro IPR006202, Neur_chan_lig-bd IPR036734, Neur_chan_lig-bd_sf IPR006201, Neur_channel IPR036719, Neuro-gated_channel_TM_sf IPR006029, Neurotrans-gated_channel_TM |
PANTHERi | PTHR18945, PTHR18945, 1 hit |
Pfami | View protein in Pfam PF02931, Neur_chan_LBD, 1 hit PF02932, Neur_chan_memb, 1 hit |
SUPFAMi | SSF63712, SSF63712, 1 hit SSF90112, SSF90112, 1 hit |
ProtoNeti | Search... |
MobiDBi | Search... |
Entry informationi
Entry namei | 5HT3D_HUMAN | |
Accessioni | Q70Z44Primary (citable) accession number: Q70Z44 Secondary accession number(s): C9J2I6 Q7Z6B3 | |
Entry historyi | Integrated into UniProtKB/Swiss-Prot: | December 4, 2007 |
Last sequence update: | June 28, 2011 | |
Last modified: | December 2, 2020 | |
This is version 149 of the entry and version 3 of the sequence. See complete history. | ||
Entry statusi | Reviewed (UniProtKB/Swiss-Prot) | |
Annotation program | Chordata Protein Annotation Program | |
Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. |
Miscellaneousi
Keywords - Technical termi
Reference proteomeDocuments
- Human chromosome 3
Human chromosome 3: entries, gene names and cross-references to MIM - Human polymorphisms and disease mutations
Index of human polymorphisms and disease mutations - MIM cross-references
Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot - SIMILARITY comments
Index of protein domains and families - Human entries with polymorphisms or disease mutations
List of human entries with polymorphisms or disease mutations