Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q70IA6 (MOB2_HUMAN)

Entry version 124 (08 May 2019)
Sequence version 1 (05 Jul 2004)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

MOB kinase activator 2

Gene

MOB2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Stimulates the autophosphorylation and kinase activity of STK38 and STK38L.1 Publication

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the ‘Description’ field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi78ZincBy similarity1
Metal bindingi83ZincBy similarity1
Metal bindingi157ZincBy similarity1
Metal bindingi162ZincBy similarity1

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

View the complete GO annotation on QuickGO ...

GO - Biological processi

View the complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

LigandMetal-binding, Zinc

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
MOB kinase activator 2
Alternative name(s):
HCCA2
Mob2 homolog
Mps one binder kinase activator-like 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:MOB2
Synonyms:HCCA2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:24904 MOB2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		611969 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q70IA6

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		81532

Open Targets

More...OpenTargetsi		ENSG00000182208

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		MOB2

Domain mapping of disease mutations (DMDM)

More...DMDMi		56749258

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001935681 – 237MOB kinase activator 2Add BLAST237

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated.

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q70IA6

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q70IA6

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q70IA6

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q70IA6

PeptideAtlas

More...PeptideAtlasi		Q70IA6

PRoteomics IDEntifications database

More...PRIDEi		Q70IA6

ProteomicsDB human proteome resource

More...ProteomicsDBi		68555
68556 [Q70IA6-2]

PTM databases

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q70IA6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000182208 Expressed in 195 organ(s), highest expression level in lower esophagus

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q70IA6 baseline and differential

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA046313

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Binds STK38 and STK38L.

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

WithEntry#Exp.IntActNotes
STK38LQ9Y2H16EBI-2558739,EBI-991501

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		123506, 16 interactors

Protein interaction database and analysis system

More...IntActi		Q70IA6, 14 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000328694

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q70IA6

Database of comparative protein structure models

More...ModBasei		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MOB1/phocein family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0440 Eukaryota
ENOG410XSUJ LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00950000182681

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000164685

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q70IA6

Identification of Orthologs from Complete Genome Data

More...OMAi		AHIYSSH

Database of Orthologous Groups

More...OrthoDBi		1127941at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q70IA6

TreeFam database of animal gene trees

More...TreeFami		TF300789

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.20.140.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR005301 MOB_kinase_act_fam
IPR036703 MOB_kinase_act_sf

The PANTHER Classification System

More...PANTHERi		PTHR22599 PTHR22599, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF03637 Mob1_phocein, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM01388 Mob1_phocein, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF101152 SSF101152, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q70IA6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDWLMGKSKA KPNGKKPAAE ERKAYLEPEH TKARITDFQF KELVVLPREI 
        60         70         80         90        100
DLNEWLASNT TTFFHHINLQ YSTISEFCTG ETCQTMAVCN TQYYWYDERG 
       110        120        130        140        150
KKVKCTAPQY VDFVMSSVQK LVTDEDVFPT KYGREFPSSF ESLVRKICRH 
       160        170        180        190        200
LFHVLAHIYW AHFKETLALE LHGHLNTLYV HFILFAREFN LLDPKETAIM 
       210        220        230 
DDLTEVLCSG AGGVHSGGSG DGAGSGGPGA QNHVKER
Length:237
Mass (Da):26,927
Last modified:July 5, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i878A3E6E49294689
GO
Isoform 2 (identifier: Q70IA6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     133-142: GREFPSSFES → ENSPAPLSPW
     143-237: Missing.

Note: No experimental confirmation available.
Show »
Length:142
Mass (Da):16,500
Checksum:i1C519E331CFE4F56
GO
Isoform 3 (identifier: Q70IA6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-6: MDWLMG → MLGDHCSLPEDQARPGQSLQSGLCCKMVLQAVSKVLR

Show »
Length:268
Mass (Da):30,174
Checksum:i17AFFA11E89352B5
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WVS8A0A087WVS8_HUMAN
MOB kinase activator 2
MOB2
234Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti49E → K in BAB71443 (PubMed:14702039).Curated1
Isoform 3 (identifier: Q70IA6-3)
Sequence conflicti19L → P in BAG59255 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0444721 – 6MDWLMG → MLGDHCSLPEDQARPGQSLQ SGLCCKMVLQAVSKVLR in isoform 3. 1 Publication6
Alternative sequenceiVSP_012298133 – 142GREFPSSFES → ENSPAPLSPW in isoform 2. 1 Publication10
Alternative sequenceiVSP_012299143 – 237Missing in isoform 2. 1 PublicationAdd BLAST95

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AJ580639 mRNA Translation: CAE45271.1
AK057350 mRNA Translation: BAB71443.1
AK296658 mRNA Translation: BAG59255.1
AC091196 Genomic DNA No translation available.
BC047291 mRNA Translation: AAH47291.1
BC067785 mRNA Translation: AAH67785.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS53591.1 [Q70IA6-3]

NCBI Reference Sequences

More...RefSeqi		NP_001165694.1, NM_001172223.2 [Q70IA6-3]
NP_443731.2, NM_053005.5 [Q70IA6-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000329957; ENSP00000328694; ENSG00000182208 [Q70IA6-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		81532

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:81532

UCSC genome browser

More...UCSCi		uc010qwz.3 human [Q70IA6-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ580639 mRNA Translation: CAE45271.1
AK057350 mRNA Translation: BAB71443.1
AK296658 mRNA Translation: BAG59255.1
AC091196 Genomic DNA No translation available.
BC047291 mRNA Translation: AAH47291.1
BC067785 mRNA Translation: AAH67785.1
CCDSiCCDS53591.1 [Q70IA6-3]
RefSeqiNP_001165694.1, NM_001172223.2 [Q70IA6-3]
NP_443731.2, NM_053005.5 [Q70IA6-1]

3D structure databases

SMRiQ70IA6
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123506, 16 interactors
IntActiQ70IA6, 14 interactors
STRINGi9606.ENSP00000328694

PTM databases

PhosphoSitePlusiQ70IA6

Polymorphism and mutation databases

BioMutaiMOB2
DMDMi56749258

Proteomic databases

EPDiQ70IA6
jPOSTiQ70IA6
MaxQBiQ70IA6
PaxDbiQ70IA6
PeptideAtlasiQ70IA6
PRIDEiQ70IA6
ProteomicsDBi68555
68556 [Q70IA6-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000329957; ENSP00000328694; ENSG00000182208 [Q70IA6-3]
GeneIDi81532
KEGGihsa:81532
UCSCiuc010qwz.3 human [Q70IA6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		81532
DisGeNETi81532

GeneCards: human genes, protein and diseases

More...GeneCardsi		MOB2
HGNCiHGNC:24904 MOB2
HPAiHPA046313
MIMi611969 gene
neXtProtiNX_Q70IA6
OpenTargetsiENSG00000182208

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0440 Eukaryota
ENOG410XSUJ LUCA
GeneTreeiENSGT00950000182681
HOGENOMiHOG000164685
InParanoidiQ70IA6
OMAiAHIYSSH
OrthoDBi1127941at2759
PhylomeDBiQ70IA6
TreeFamiTF300789

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		MOB2 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		81532

Protein Ontology

More...PROi		PR:Q70IA6

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000182208 Expressed in 195 organ(s), highest expression level in lower esophagus
ExpressionAtlasiQ70IA6 baseline and differential

Family and domain databases

Gene3Di1.20.140.30, 1 hit
InterProiView protein in InterPro
IPR005301 MOB_kinase_act_fam
IPR036703 MOB_kinase_act_sf
PANTHERiPTHR22599 PTHR22599, 1 hit
PfamiView protein in Pfam
PF03637 Mob1_phocein, 1 hit
SMARTiView protein in SMART
SM01388 Mob1_phocein, 1 hit
SUPFAMiSSF101152 SSF101152, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiMOB2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q70IA6
Secondary accession number(s): B4DKP3, Q96M67
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 21, 2004
Last sequence update: July 5, 2004
Last modified: May 8, 2019
This is version 124 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again