Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 138 (26 Feb 2020)
Sequence version 3 (25 Nov 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Ras-associated and pleckstrin homology domains-containing protein 1

Gene

RAPH1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Mediator of localized membrane signals. Implicated in the regulation of lamellipodial dynamics. Negatively regulates cell adhesion.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ras-associated and pleckstrin homology domains-containing protein 1
Short name:
RAPH1
Alternative name(s):
Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 18 protein
Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 9 protein
Lamellipodin
Proline-rich EVH1 ligand 2
Short name:
PREL-2
Protein RMO1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RAPH1
Synonyms:ALS2CR18, ALS2CR9, KIAA1681, LPD, PREL2, RMO1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:14436 RAPH1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609035 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q70E73

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell membrane, Cell projection, Cytoplasm, Cytoskeleton, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
65059

Open Targets

More...
OpenTargetsi
ENSG00000173166

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA24749

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q70E73 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
RAPH1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
215274220

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001813521 – 1250Ras-associated and pleckstrin homology domains-containing protein 1Add BLAST1250

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei1N-acetylmethionineCombined sources1
Modified residuei5PhosphoserineCombined sources1
Modified residuei17PhosphoserineCombined sources1
Modified residuei54PhosphoserineCombined sources1
Modified residuei150PhosphoserineCombined sources1
Modified residuei192PhosphoserineCombined sources1
Modified residuei203PhosphoserineCombined sources1
Modified residuei205PhosphoserineCombined sources1
Modified residuei426Phosphotyrosine; by ABL11 Publication1
Modified residuei456Phosphotyrosine; by ABL11 Publication1
Modified residuei610PhosphoserineCombined sources1
Modified residuei827PhosphoserineCombined sources1
Modified residuei830PhosphothreonineCombined sources1
Modified residuei845PhosphoserineCombined sources1
Modified residuei853PhosphoserineCombined sources1
Modified residuei894PhosphoserineCombined sources1
Modified residuei965PhosphoserineCombined sources1
Modified residuei974PhosphothreonineCombined sources1
Modified residuei996PhosphoserineCombined sources1
Modified residuei1012PhosphoserineCombined sources1
Modified residuei1183PhosphoserineCombined sources1
Modified residuei1226Phosphotyrosine; by ABL11 Publication1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q70E73

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q70E73

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q70E73

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q70E73

PeptideAtlas

More...
PeptideAtlasi
Q70E73

PRoteomics IDEntifications database

More...
PRIDEi
Q70E73

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
68527 [Q70E73-10]
68528 [Q70E73-2]
68529 [Q70E73-3]
68530 [Q70E73-4]
68531 [Q70E73-5]
68532 [Q70E73-6]
68533 [Q70E73-7]
68534 [Q70E73-8]
68535 [Q70E73-9]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q70E73

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q70E73

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform RMO1-RAPH1 is ubiquitously expressed with highest levels in brain, heart, ovary and developing embryo. Isoform RMO1 is widely expressed with highest levels in liver. Low expression in B-cells.2 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Reduced expression in metastatic osteosarcomas compared to primary osteosarcoma tumors. Down-regulated in both breast (43% of tissue samples) and ovarian (25% of tissue samples) cancers.

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000173166 Expressed in epithelial cell of pancreas and 211 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q70E73 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q70E73 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA016744
HPA020027

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with EVL and VASP and targets them to the leading edge (PubMed:15469845).

Interacts (via Ras associating and PH domains) with RAC1 (PubMed:18499456).

2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Show more details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
122380, 21 interactors

Database of interacting proteins

More...
DIPi
DIP-61336N

Protein interaction database and analysis system

More...
IntActi
Q70E73, 15 interactors

Molecular INTeraction database

More...
MINTi
Q70E73

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000316543

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q70E73 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11250
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q70E73

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini269 – 355Ras-associatingPROSITE-ProRule annotationAdd BLAST87
Domaini396 – 505PHPROSITE-ProRule annotationAdd BLAST110

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the MRL family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3751 Eukaryota
ENOG410XXC8 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000156552

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_022700_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q70E73

KEGG Orthology (KO)

More...
KOi
K23488

Database of Orthologous Groups

More...
OrthoDBi
786893at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q70E73

TreeFam database of animal gene trees

More...
TreeFami
TF317511

Family and domain databases

Conserved Domains Database

More...
CDDi
cd01259 PH_APBB1IP, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR039664 GRB/APBB1IP
IPR011993 PH-like_dom_sf
IPR039665 PH_APBB1IP
IPR001849 PH_domain
IPR000159 RA_dom
IPR029071 Ubiquitin-like_domsf

The PANTHER Classification System

More...
PANTHERi
PTHR11243 PTHR11243, 2 hits

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00169 PH, 1 hit
PF00788 RA, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00233 PH, 1 hit
SM00314 RA, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54236 SSF54236, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50003 PH_DOMAIN, 1 hit
PS50200 RA, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (9+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 9 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 9 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform RMO1-RAPH1 (identifier: Q70E73-10) [UniParc]FASTAAdd to basket
Also known as: Lamellipodin, RAPH1

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEQLSDEEID HGAEEDSDKE DQDLDKMFGA WLGELDKLTQ SLDSDKPMEP
60 70 80 90 100
VKRSPLRQET NMANFSYRFS IYNLNEALNQ GETVDLDALM ADLCSIEQEL
110 120 130 140 150
SSIGSGNSKR QITETKATQK LPVSRHTLKH GTLKGLSSSS NRIAKPSHAS
160 170 180 190 200
YSLDDVTAQL EQASLSMDEA AQQSVLEDTK PLVTNQHRRT ASAGTVSDAE
210 220 230 240 250
VHSISNSSHS SITSAASSMD SLDIDKVTRP QELDLTHQGQ PITEEEQAAK
260 270 280 290 300
LKAEKIRVAL EKIKEAQVKK LVIRVHMSDD SSKTMMVDER QTVRQVLDNL
310 320 330 340 350
MDKSHCGYSL DWSLVETVSE LQMERIFEDH ENLVENLLNW TRDSQNKLIF
360 370 380 390 400
MERIEKYALF KNPQNYLLGK KETAEMADRN KEVLLEECFC GSSVTVPEIE
410 420 430 440 450
GVLWLKDDGK KSWKKRYFLL RASGIYYVPK GKAKVSRDLV CFLQLDHVNV
460 470 480 490 500
YYGQDYRNKY KAPTDYCLVL KHPQIQKKSQ YIKYLCCDDV RTLHQWVNGI
510 520 530 540 550
RIAKYGKQLY MNYQEALKRT ESAYDWTSLS SSSIKSGSSS SSIPESQSNH
560 570 580 590 600
SNQSDSGVSD TQPAGHVRSQ SIVSSVFSEA WKRGTQLEES SKARMESMNR
610 620 630 640 650
PYTSLVPPLS PQPKIVTPYT ASQPSPPLPP PPPPPPPPPP PPPPPPPPLP
660 670 680 690 700
SQSAPSAGSA APMFVKYSTI TRLQNASQHS GALFKPPTPP VMQSQSVKPQ
710 720 730 740 750
ILVPPNGVVP PPPPPPPPPT PGSAMAQLKP APCAPSLPQF SAPPPPLKIH
760 770 780 790 800
QVQHITQVAP PTPPPPPPIP APLPPQAPPK PLVTIPAPTS TKTVAPVVTQ
810 820 830 840 850
AAPPTPTPPV PPAKKQPAFP ASYIPPSPPT PPVPVPPPTL PKQQSFCAKP
860 870 880 890 900
PPSPLSPVPS VVKQIASQFP PPPTPPAMES QPLKPVPANV APQSPPAVKA
910 920 930 940 950
KPKWQPSSIP VPSPDFPPPP PESSLVFPPP PPSPVPAPPP PPPPTASPTP
960 970 980 990 1000
DKSGSPGKKT SKTSSPGGKK PPPTPQRNSS IKSSSGAEHP EPKRPSVDSL
1010 1020 1030 1040 1050
VSKFTPPAES GSPSKETLPP PAAPPKPGKL NLSGVNLPGV LQQGCVSAKA
1060 1070 1080 1090 1100
PVLSGRGKDS VVEFPSPPSD SDFPPPPPET ELPLPPIEIP AVFSGNTSPK
1110 1120 1130 1140 1150
VAVVNPQPQQ WSKMSVKKAP PPTRPKRNDS TRLTQAEISE QPTMATVVPQ
1160 1170 1180 1190 1200
VPTSPKSSLS VQPGFLADLN RTLQRKSITR HGSLSSRMSR AEPTATMDDM
1210 1220 1230 1240 1250
ALPPPPPELL SDQQKAGYGG SHISGYATLR RGPPPAPPKR DQNTKLSRDW
Length:1,250
Mass (Da):135,256
Last modified:November 25, 2008 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1DFB651F945DA3DC
GO
Isoform RMO1 (identifier: Q70E73-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     593-597: ARMES → VTASF
     598-1250: Missing.

Show »
Length:597
Mass (Da):67,456
Checksum:i75BDB66A42373617
GO
Isoform RMO1a (identifier: Q70E73-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     244-244: E → EHAISLRCSSKQAKRHIDFTEEQAELTP
     593-597: ARMES → VTASF
     598-1250: Missing.

Show »
Length:624
Mass (Da):70,534
Checksum:i64CEFFB3F5491DBE
GO
Isoform RMO1b (identifier: Q70E73-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     244-244: E → EHSYLDRETSLLLRNIAGKPSHLLTK
     593-597: ARMES → VTASF
     598-1250: Missing.

Show »
Length:622
Mass (Da):70,301
Checksum:iD4492E1C4D82C239
GO
Isoform RMO1c (identifier: Q70E73-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     593-1250: Missing.

Show »
Length:592
Mass (Da):66,950
Checksum:i07361715124582FF
GO
Isoform RMO1ab (identifier: Q70E73-6) [UniParc]FASTAAdd to basket
Also known as: Lamellipodin-S, Lpd-S

The sequence of this isoform differs from the canonical sequence as follows:
     244-244: E → EHAISLRCSSKQAKRHIDFTEEQAELTPHSYLDRETSLLLRNIAGKPSHLLTK
     593-597: ARMES → VTASF
     598-1250: Missing.

Show »
Length:649
Mass (Da):73,379
Checksum:i3B54297D886F095B
GO
Isoform RMO1ac (identifier: Q70E73-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     244-244: E → EHAISLRCSSKQAKRHIDFTEEQAELTP
     593-1250: Missing.

Show »
Length:619
Mass (Da):70,028
Checksum:i691DBE08F3FC2768
GO
Isoform RMO1bc (identifier: Q70E73-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     244-244: E → EHSYLDRETSLLLRNIAGKPSHLLTK
     593-1250: Missing.

Show »
Length:617
Mass (Da):69,795
Checksum:iE2C239CF09D9A2F4
GO
Isoform RMO1abc (identifier: Q70E73-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     244-244: E → EHAISLRCSSKQAKRHIDFTEEQAELTPHSYLDRETSLLLRNIAGKPSHLLTK
     593-1250: Missing.

Show »
Length:644
Mass (Da):72,874
Checksum:iBF095B6EDA528735
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
C9K0J5C9K0J5_HUMAN
Ras association (RalGDS/AF-6) and p...
RAPH1 hCG_2043066
1,302Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J164C9J164_HUMAN
Ras-associated and pleckstrin homol...
RAPH1
594Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J0R8C9J0R8_HUMAN
Ras-associated and pleckstrin homol...
RAPH1
89Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9JLG4C9JLG4_HUMAN
Ras-associated and pleckstrin homol...
RAPH1
172Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1081E → D in AAS82582 (PubMed:15469845).Curated1
Sequence conflicti1081E → D in CAE48361 (PubMed:15586368).Curated1
Sequence conflicti1081E → D in BAB21772 (PubMed:11214970).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_036009891A → S in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_0360101228T → A in a breast cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs774304253Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_035784244E → EHAISLRCSSKQAKRHIDFT EEQAELTP in isoform RMO1a and isoform RMO1ac. Curated1
Alternative sequenceiVSP_035785244E → EHAISLRCSSKQAKRHIDFT EEQAELTPHSYLDRETSLLL RNIAGKPSHLLTK in isoform RMO1ab and isoform RMO1abc. 2 Publications1
Alternative sequenceiVSP_035786244E → EHSYLDRETSLLLRNIAGKP SHLLTK in isoform RMO1b and isoform RMO1bc. Curated1
Alternative sequenceiVSP_035787593 – 1250Missing in isoform RMO1c, isoform RMO1ac, isoform RMO1bc and isoform RMO1abc. 1 PublicationAdd BLAST658
Alternative sequenceiVSP_035788593 – 597ARMES → VTASF in isoform RMO1, isoform RMO1a, isoform RMO1b and isoform RMO1ab. 2 Publications5
Alternative sequenceiVSP_035789598 – 1250Missing in isoform RMO1, isoform RMO1a, isoform RMO1b and isoform RMO1ab. 2 PublicationsAdd BLAST653

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB053311 mRNA Translation: BAB69020.1
AY494951 mRNA Translation: AAS82582.1
AY523977 mRNA Translation: AAS16935.1
AY523978 mRNA Translation: AAS16936.1
AJ584699 mRNA Translation: CAE48361.1
AC018891 Genomic DNA Translation: AAY14676.1
AB051468 mRNA Translation: BAB21772.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2359.1 [Q70E73-10]
CCDS2360.1 [Q70E73-9]

NCBI Reference Sequences

More...
RefSeqi
NP_976241.1, NM_203365.3 [Q70E73-9]
NP_998754.1, NM_213589.2 [Q70E73-10]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000308091; ENSP00000311293; ENSG00000173166 [Q70E73-9]
ENST00000319170; ENSP00000316543; ENSG00000173166 [Q70E73-10]
ENST00000418114; ENSP00000396711; ENSG00000173166 [Q70E73-2]
ENST00000419464; ENSP00000390578; ENSG00000173166 [Q70E73-5]
ENST00000423104; ENSP00000397751; ENSG00000173166 [Q70E73-7]
ENST00000439222; ENSP00000411138; ENSG00000173166 [Q70E73-8]
ENST00000453034; ENSP00000406662; ENSG00000173166 [Q70E73-6]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
65059

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:65059

UCSC genome browser

More...
UCSCi
uc002vad.5 human [Q70E73-10]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB053311 mRNA Translation: BAB69020.1
AY494951 mRNA Translation: AAS82582.1
AY523977 mRNA Translation: AAS16935.1
AY523978 mRNA Translation: AAS16936.1
AJ584699 mRNA Translation: CAE48361.1
AC018891 Genomic DNA Translation: AAY14676.1
AB051468 mRNA Translation: BAB21772.1
CCDSiCCDS2359.1 [Q70E73-10]
CCDS2360.1 [Q70E73-9]
RefSeqiNP_976241.1, NM_203365.3 [Q70E73-9]
NP_998754.1, NM_213589.2 [Q70E73-10]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4GMVX-ray2.40A/B240-520[»]
4GN1X-ray2.40A/B/C/D266-520[»]
SMRiQ70E73
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGridi122380, 21 interactors
DIPiDIP-61336N
IntActiQ70E73, 15 interactors
MINTiQ70E73
STRINGi9606.ENSP00000316543

PTM databases

iPTMnetiQ70E73
PhosphoSitePlusiQ70E73

Polymorphism and mutation databases

BioMutaiRAPH1
DMDMi215274220

Proteomic databases

EPDiQ70E73
jPOSTiQ70E73
MassIVEiQ70E73
PaxDbiQ70E73
PeptideAtlasiQ70E73
PRIDEiQ70E73
ProteomicsDBi68527 [Q70E73-10]
68528 [Q70E73-2]
68529 [Q70E73-3]
68530 [Q70E73-4]
68531 [Q70E73-5]
68532 [Q70E73-6]
68533 [Q70E73-7]
68534 [Q70E73-8]
68535 [Q70E73-9]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
65059

Genome annotation databases

EnsembliENST00000308091; ENSP00000311293; ENSG00000173166 [Q70E73-9]
ENST00000319170; ENSP00000316543; ENSG00000173166 [Q70E73-10]
ENST00000418114; ENSP00000396711; ENSG00000173166 [Q70E73-2]
ENST00000419464; ENSP00000390578; ENSG00000173166 [Q70E73-5]
ENST00000423104; ENSP00000397751; ENSG00000173166 [Q70E73-7]
ENST00000439222; ENSP00000411138; ENSG00000173166 [Q70E73-8]
ENST00000453034; ENSP00000406662; ENSG00000173166 [Q70E73-6]
GeneIDi65059
KEGGihsa:65059
UCSCiuc002vad.5 human [Q70E73-10]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
65059
DisGeNETi65059

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RAPH1
HGNCiHGNC:14436 RAPH1
HPAiHPA016744
HPA020027
MIMi609035 gene
neXtProtiNX_Q70E73
OpenTargetsiENSG00000173166
PharmGKBiPA24749

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3751 Eukaryota
ENOG410XXC8 LUCA
GeneTreeiENSGT00940000156552
HOGENOMiCLU_022700_0_0_1
InParanoidiQ70E73
KOiK23488
OrthoDBi786893at2759
PhylomeDBiQ70E73
TreeFamiTF317511

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
RAPH1 human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
RAPH1

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
65059
PharosiQ70E73 Tbio

Protein Ontology

More...
PROi
PR:Q70E73
RNActiQ70E73 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000173166 Expressed in epithelial cell of pancreas and 211 other tissues
ExpressionAtlasiQ70E73 baseline and differential
GenevisibleiQ70E73 HS

Family and domain databases

CDDicd01259 PH_APBB1IP, 1 hit
Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR039664 GRB/APBB1IP
IPR011993 PH-like_dom_sf
IPR039665 PH_APBB1IP
IPR001849 PH_domain
IPR000159 RA_dom
IPR029071 Ubiquitin-like_domsf
PANTHERiPTHR11243 PTHR11243, 2 hits
PfamiView protein in Pfam
PF00169 PH, 1 hit
PF00788 RA, 1 hit
SMARTiView protein in SMART
SM00233 PH, 1 hit
SM00314 RA, 1 hit
SUPFAMiSSF54236 SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS50003 PH_DOMAIN, 1 hit
PS50200 RA, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRAPH1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q70E73
Secondary accession number(s): Q96Q37, Q9C0I2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 22, 2005
Last sequence update: November 25, 2008
Last modified: February 26, 2020
This is version 138 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again