Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 112 (07 Apr 2021)
Sequence version 3 (28 Mar 2018)
Previous versions | rss
Add a publicationFeedback
Protein

Kielin/chordin-like protein

Gene

KCP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Enhances bone morphogenetic protein (BMP) signaling in a paracrine manner. In contrast, it inhibits both the activin-A and TGFB1-mediated signaling pathways (By similarity).By similarity

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q6ZWJ8

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Kielin/chordin-like proteinCurated
Alternative name(s):
Cysteine-rich BMP regulator 2
Cysteine-rich motor neuron 2 protein
Short name:
CRIM-2
Kielin/chordin-like protein 1
Short name:
KCP-1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:KCPImported
Synonyms:CRIM2, KCP1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:17585, KCP

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
609344, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6ZWJ8

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000135253.13

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
375616

Open Targets

More...
OpenTargetsi
ENSG00000135253

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA164721151

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q6ZWJ8, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
KCP

Domain mapping of disease mutations (DMDM)

More...
DMDMi
218511989

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 23Sequence analysisAdd BLAST23
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000031858624 – 1568Kielin/chordin-like proteinSequence analysisAdd BLAST1545

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi340N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi499N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi1090N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi1237 ↔ 1245PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q6ZWJ8

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6ZWJ8

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q6ZWJ8

PeptideAtlas

More...
PeptideAtlasi
Q6ZWJ8

PRoteomics IDEntifications database

More...
PRIDEi
Q6ZWJ8

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
68490 [Q6ZWJ8-2]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...
GlyGeni
Q6ZWJ8, 5 sites, 2 O-linked glycans (2 sites)

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6ZWJ8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000135253, Expressed in cortex of kidney and 129 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6ZWJ8, baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with BMP7 and, by doing so, enhances binding to the type I receptors that contains cytoplasmic serine/threonine protein kinase domains. Also able to interact with activin-A and TGFB1 (By similarity).

By similarity

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q6ZWJ8, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6ZWJ8

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini136 – 193VWFC 1PROSITE-ProRule annotationAdd BLAST58
Domaini194 – 253VWFC 2PROSITE-ProRule annotationAdd BLAST60
Domaini253 – 312VWFC 3PROSITE-ProRule annotationAdd BLAST60
Domaini312 – 370VWFC 4PROSITE-ProRule annotationAdd BLAST59
Domaini426 – 485VWFC 5PROSITE-ProRule annotationAdd BLAST60
Domaini485 – 544VWFC 6PROSITE-ProRule annotationAdd BLAST60
Domaini544 – 602VWFC 7PROSITE-ProRule annotationAdd BLAST59
Domaini602 – 661VWFC 8PROSITE-ProRule annotationAdd BLAST60
Domaini667 – 725VWFC 9PROSITE-ProRule annotationAdd BLAST59
Domaini725 – 782VWFC 10PROSITE-ProRule annotationAdd BLAST58
Domaini782 – 841VWFC 11PROSITE-ProRule annotationAdd BLAST60
Domaini900 – 959VWFC 12PROSITE-ProRule annotationAdd BLAST60
Domaini959 – 1017VWFC 13PROSITE-ProRule annotationAdd BLAST59
Domaini1017 – 1085VWFC 14PROSITE-ProRule annotationAdd BLAST69
Domaini1082 – 1145VWFC 15PROSITE-ProRule annotationAdd BLAST64
Domaini1149 – 1209VWFC 16PROSITE-ProRule annotationAdd BLAST61
Domaini1214 – 1426VWFDPROSITE-ProRule annotationAdd BLAST213
Domaini1483 – 1543TILAdd BLAST61

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili60 – 87Sequence analysisAdd BLAST28

Keywords - Domaini

Coiled coil, Repeat, Signal

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000160243

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6ZWJ8

Database of Orthologous Groups

More...
OrthoDBi
1104860at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6ZWJ8

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR036084, Ser_inhib-like_sf
IPR014853, Unchr_dom_Cys-rich
IPR001007, VWF_dom
IPR001846, VWF_type-D

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00093, VWC, 9 hits
PF00094, VWD, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00832, C8, 1 hit
SM00214, VWC, 19 hits
SM00215, VWC_out, 8 hits
SM00216, VWD, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57567, SSF57567, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01208, VWFC_1, 13 hits
PS50184, VWFC_2, 16 hits
PS51233, VWFD, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 3 (identifier: Q6ZWJ8-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGVGAAALS LLLHLGALAL AAGAEGGAVP REPPGQQTTA HSSVLAGNSQ
60 70 80 90 100
EQWHPLREWL GRLEAAVMEL REQNKDLQTR VRQLESCECH PASPQCWGLG
110 120 130 140 150
RAWPEGARWE PDACTACVCQ DGAAHCGPQA HLPHCRGCSQ NGQTYGNGET
160 170 180 190 200
FSPDACTTCR CLTGAVQCQG PSCSELNCLE SCTPPGECCP ICRPGCDYEG
210 220 230 240 250
QLYEEGVTFL SSSNPCLQCT CLRSRVRCMA LKCPPSPCPE PVLRPGHCCP
260 270 280 290 300
TCQGCTEGGS HWEHGQEWTT PGDPCRICRC LEGHIQCRQR ECASLCPYPA
310 320 330 340 350
RPLPGTCCPV CDGCFLNGRE HRSGEPVGSG DPCSHCRCAN GSVQCEPLPC
360 370 380 390 400
PPVPCRHPGK IPGQCCPVCD GCEYQGHQYQ SQETFRLQER GLCVRCSCQA
410 420 430 440 450
GEVSCEEQEC PVTPCALPAS GRQLCPACEL DGEEFAEGVQ WEPDGRPCTA
460 470 480 490 500
CVCQDGVPKC GAVLCPPAPC QHPTQPPGAC CPSCDSCTYH SQVYANGQNF
510 520 530 540 550
TDADSPCHAC HCQDGTVTCS LVDCPPTTCA RPQSGPGQCC PRCPDCILEE
560 570 580 590 600
EVFVDGESFS HPRDPCQECR CQEGHAHCQP RPCPRAPCAH PLPGTCCPND
610 620 630 640 650
CSGCAFGGKE YPSGADFPHP SDPCRLCRCL SGNVQCLARR CVPLPCPEPV
660 670 680 690 700
LLPGECCPQC PAAPAPAGCP RPGAAHARHQ EYFSPPGDPC RRCLCLDGSV
710 720 730 740 750
SCQRLPCPPA PCAHPRQGPC CPSCDGCLYQ GKEFASGERF PSPTAACHLC
760 770 780 790 800
LCWEGSVSCE PKACAPALCP FPARGDCCPD CDGCEYLGES YLSNQEFPDP
810 820 830 840 850
REPCNLCTCL GGFVTCGRRP CEPPGCSHPL IPSGHCCPTC QGCRYHGVTT
860 870 880 890 900
ASGETLPDPL DPTCSLCTCQ EGSMRCQKKP CPPALCPHPS PGPCFCPVCH
910 920 930 940 950
SCLSQGREHQ DGEEFEGPAG SCEWCRCQAG QVSCVRLQCP PLPCKLQVTE
960 970 980 990 1000
RGSCCPRCRG CLAHGEEHPE GSRWVPPDSA CSSCVCHEGV VTCARIQCIS
1010 1020 1030 1040 1050
SCAQPRQGPH DCCPQCSDCE HEGRKYEPGE SFQPGADPCE VCICEPQPEG
1060 1070 1080 1090 1100
PPSLRCHRRQ CPSLVGCPPS QLLPPGPQHC CPTCAEALSN CSEGLLGSEL
1110 1120 1130 1140 1150
APPDPCYTCQ CQDLTWLCIH QACPELSCPL SERHTPPGSC CPVCRAPTQS
1160 1170 1180 1190 1200
CVHQGREVAS GERWTVDTCT SCSCMAGTVR CQSQRCSPLS CGPDKAPALS
1210 1220 1230 1240 1250
PGSCCPRCLP RPASCMAFGD PHYRTFDGRL LHFQGSCSYV LAKDCHSGDF
1260 1270 1280 1290 1300
SVHVTNDDRG RSGVAWTQEV AVLLGDMAVR LLQDGAVTVD GHPVALPFLQ
1310 1320 1330 1340 1350
EPLLYVELRG HTVILHAQPG LQVLWDGQSQ VEVSVPGSYQ GRTCGLCGNF
1360 1370 1380 1390 1400
NGFAQDDLQG PEGLLLPSEA AFGNSWQVSE GLWPGRPCSA GREVDPCRAA
1410 1420 1430 1440 1450
GYRARREANA RCGVLKSSPF SRCHAVVPPE PFFAACVYDL CACGPGSSAD
1460 1470 1480 1490 1500
ACLCDALEAY ASHCRQAGVT PTWRGPTLCV VGCPLERGFV FDECGPPCPR
1510 1520 1530 1540 1550
TCFNQHIPLG ELAAHCVRPC VPGCQCPAGL VEHEAHCIPP EACPQVLLTG
1560
DQPLGARPSP SREPQETP
Length:1,568
Mass (Da):166,935
Last modified:March 28, 2018 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7C63B5766B3EA7F3
GO
Isoform 2 (identifier: Q6ZWJ8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1174: Missing.
     1379-1468: SEGLWPGRPC...AYASHCRQAG → QEGRGYPPGL...LKASCDGSRL
     1469-1568: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:294
Mass (Da):31,744
Checksum:i12152D81A55C0925
GO
Isoform 4 (identifier: Q6ZWJ8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     163-193: TGAVQCQGPSCSELNCLESCTPPGECCPICR → EGTITCNQKPCPRGPCPEPGACCPHCK
     784-818: CEYLGESYLSNQEFPDPREPCNLCTCLGGFVTCGR → EGHGIGSCRGGMRETRGLGQNNLYCPRVDLKYLLQ
     819-1568: Missing.

Show »
Length:814
Mass (Da):86,623
Checksum:iE4AF99A652A76474
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A087WVT8A0A087WVT8_HUMAN
Kielin/chordin-like protein
KCP
1,628Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087X1L3A0A087X1L3_HUMAN
Kielin/chordin-like protein
KCP
1,504Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WXB2A0A087WXB2_HUMAN
Kielin/chordin-like protein
KCP
1,275Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A7I2V446A0A7I2V446_HUMAN
Kielin/chordin-like protein
KCP
308Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti214N → K in BAC85504 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03878347G → E. Corresponds to variant dbSNP:rs7787221Ensembl.1
Natural variantiVAR_059625459K → E1 PublicationCorresponds to variant dbSNP:rs7782976Ensembl.1
Natural variantiVAR_059626688D → V1 PublicationCorresponds to variant dbSNP:rs3734971Ensembl.1
Natural variantiVAR_0596271193P → R. Corresponds to variant dbSNP:rs7786641Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0593521 – 1174Missing in isoform 2. Add BLAST1174
Alternative sequenceiVSP_059353163 – 193TGAVQ…CPICR → EGTITCNQKPCPRGPCPEPG ACCPHCK in isoform 4. Add BLAST31
Alternative sequenceiVSP_059354784 – 818CEYLG…VTCGR → EGHGIGSCRGGMRETRGLGQ NNLYCPRVDLKYLLQ in isoform 4. Add BLAST35
Alternative sequenceiVSP_059355819 – 1568Missing in isoform 4. Add BLAST750
Alternative sequenceiVSP_0593561379 – 1468SEGLW…CRQAG → QEGRGYPPGLELPPVLLQME WSRRAQEQLLWDLELLTGVE LGLFWPPQAQFFGPRGQAQQ AWSQCCQPGGSTGGDPEQPI LKASCDGSRL in isoform 2. Add BLAST90
Alternative sequenceiVSP_0593571469 – 1568Missing in isoform 2. Add BLAST100

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK122706 mRNA Translation: BAC85504.1
AK090684 mRNA Translation: BAC03505.1
AC025594 Genomic DNA No translation available.
KF495713 Genomic DNA No translation available.
KF510975 Genomic DNA No translation available.
CH471070 Genomic DNA Translation: EAW83694.1

NCBI Reference Sequences

More...
RefSeqi
NP_001129386.1, NM_001135914.1
NP_955381.2, NM_199349.2 [Q6ZWJ8-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000613019; ENSP00000477644; ENSG00000135253 [Q6ZWJ8-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
375616

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:375616

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122706 mRNA Translation: BAC85504.1
AK090684 mRNA Translation: BAC03505.1
AC025594 Genomic DNA No translation available.
KF495713 Genomic DNA No translation available.
KF510975 Genomic DNA No translation available.
CH471070 Genomic DNA Translation: EAW83694.1
RefSeqiNP_001129386.1, NM_001135914.1
NP_955381.2, NM_199349.2 [Q6ZWJ8-4]

3D structure databases

SMRiQ6ZWJ8
ModBaseiSearch...

PTM databases

GlyGeniQ6ZWJ8, 5 sites, 2 O-linked glycans (2 sites)
PhosphoSitePlusiQ6ZWJ8

Genetic variation databases

BioMutaiKCP
DMDMi218511989

Proteomic databases

EPDiQ6ZWJ8
jPOSTiQ6ZWJ8
MassIVEiQ6ZWJ8
PeptideAtlasiQ6ZWJ8
PRIDEiQ6ZWJ8
ProteomicsDBi68490 [Q6ZWJ8-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
73205, 24 antibodies

Genome annotation databases

EnsembliENST00000613019; ENSP00000477644; ENSG00000135253 [Q6ZWJ8-3]
GeneIDi375616
KEGGihsa:375616

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
375616
DisGeNETi375616

GeneCards: human genes, protein and diseases

More...
GeneCardsi
KCP
HGNCiHGNC:17585, KCP
MIMi609344, gene
neXtProtiNX_Q6ZWJ8
OpenTargetsiENSG00000135253
PharmGKBiPA164721151
VEuPathDBiHostDB:ENSG00000135253.13

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00940000160243
InParanoidiQ6ZWJ8
OrthoDBi1104860at2759
PhylomeDBiQ6ZWJ8

Enzyme and pathway databases

PathwayCommonsiQ6ZWJ8

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
375616, 3 hits in 126 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
375616
PharosiQ6ZWJ8, Tdark

Protein Ontology

More...
PROi
PR:Q6ZWJ8
RNActiQ6ZWJ8, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000135253, Expressed in cortex of kidney and 129 other tissues
ExpressionAtlasiQ6ZWJ8, baseline and differential

Family and domain databases

InterProiView protein in InterPro
IPR036084, Ser_inhib-like_sf
IPR014853, Unchr_dom_Cys-rich
IPR001007, VWF_dom
IPR001846, VWF_type-D
PfamiView protein in Pfam
PF00093, VWC, 9 hits
PF00094, VWD, 1 hit
SMARTiView protein in SMART
SM00832, C8, 1 hit
SM00214, VWC, 19 hits
SM00215, VWC_out, 8 hits
SM00216, VWD, 1 hit
SUPFAMiSSF57567, SSF57567, 1 hit
PROSITEiView protein in PROSITE
PS01208, VWFC_1, 13 hits
PS50184, VWFC_2, 16 hits
PS51233, VWFD, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKCP_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6ZWJ8
Secondary accession number(s): A0A087WT73, Q8NBE0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: March 28, 2018
Last modified: April 7, 2021
This is version 112 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again