Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q6ZVM7 (TM1L2_HUMAN)

Entry version 133 (16 Oct 2019)
Sequence version 1 (05 Jul 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

TOM1-like protein 2

Gene

TOM1L2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Probable role in protein transport. May regulate growth factor-induced mitogenic signaling.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processProtein transport, Transport

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
TOM1-like protein 2
Alternative name(s):
Target of Myb-like protein 2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TOM1L2
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:11984 TOM1L2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		615519 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q6ZVM7

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		146691

Open Targets

More...OpenTargetsi		ENSG00000175662

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA36668

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q6ZVM7

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		TOM1L2

Domain mapping of disease mutations (DMDM)

More...DMDMi		74712301

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002787901 – 507TOM1-like protein 2Add BLAST507

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei160PhosphoserineCombined sources1
Modified residuei164PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q6ZVM7

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q6ZVM7

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q6ZVM7

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q6ZVM7

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q6ZVM7

PeptideAtlas

More...PeptideAtlasi		Q6ZVM7

PRoteomics IDEntifications database

More...PRIDEi		Q6ZVM7

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		6447
68426 [Q6ZVM7-1]
68427 [Q6ZVM7-2]
68428 [Q6ZVM7-3]
68429 [Q6ZVM7-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q6ZVM7

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q6ZVM7

Miscellaneous databases

CutDB - Proteolytic event database

More...PMAP-CutDBi		Q6ZVM7

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Ubiquitously expressed with higher expression in heart and skeletal muscle.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000175662 Expressed in 205 organ(s), highest expression level in heart left ventricle

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q6ZVM7 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q6ZVM7 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA022541
HPA023304

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with clathrin, SRC and TOLLIP.

2 Publications

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		127001, 32 interactors

Database of interacting proteins

More...DIPi		DIP-61860N

Protein interaction database and analysis system

More...IntActi		Q6ZVM7, 11 interactors

Molecular INTeraction database

More...MINTi		Q6ZVM7

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000368818

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q6ZVM7

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini20 – 152VHSPROSITE-ProRule annotationAdd BLAST133
Domaini219 – 307GATPROSITE-ProRule annotationAdd BLAST89

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi329 – 334Clathrin-binding6

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The GAT domain mediates interaction with TOLLIP.

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the TOM1 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1087 Eukaryota
ENOG410Y26G LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000156940

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000285970

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q6ZVM7

Identification of Orthologs from Complete Genome Data

More...OMAi		QAHLYRM

Database of Orthologous Groups

More...OrthoDBi		1213216at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q6ZVM7

TreeFam database of animal gene trees

More...TreeFami		TF314105

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		1.20.58.160, 1 hit
1.25.40.90, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR008942 ENTH_VHS
IPR004152 GAT_dom
IPR038425 GAT_sf
IPR014645 TOM1
IPR027429 TOM1L2
IPR002014 VHS_dom

The PANTHER Classification System

More...PANTHERi		PTHR13856:SF31 PTHR13856:SF31, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF03127 GAT, 1 hit
PF00790 VHS, 1 hit

PIRSF; a whole-protein classification database

More...PIRSFi		PIRSF036948 TOM1, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00288 VHS, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48464 SSF48464, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50909 GAT, 1 hit
PS50179 VHS, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6ZVM7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEFLLGNPFS TPVGQCLEKA TDGSLQSEDW TLNMEICDII NETEEGPKDA 
        60         70         80         90        100
IRALKKRLNG NRNYREVMLA LTVLETCVKN CGHRFHILVA NRDFIDSVLV 
       110        120        130        140        150
KIISPKNNPP TIVQDKVLAL IQAWADAFRS SPDLTGVVHI YEELKRKGVE 
       160        170        180        190        200
FPMADLDALS PIHTPQRSVP EVDPAATMPR SQSQQRTSAG SYSSPPPAPY 
       210        220        230        240        250
SAPQAPALSV TGPITANSEQ IARLRSELDV VRGNTKVMSE MLTEMVPGQE 
       260        270        280        290        300
DSSDLELLQE LNRTCRAMQQ RIVELISRVS NEEVTEELLH VNDDLNNVFL 
       310        320        330        340        350
RYERFERYRS GRSVQNASNG VLNEVTEDNL IDLGPGSPAV VSPMVGNTAP 
       360        370        380        390        400
PSSLSSQLAG LDLGTESVSG TLSSLQQCNP RDGFDMFAQT RGNSLAEQRK 
       410        420        430        440        450
TVTYEDPQAV GGLASALDNR KQSSEGIPVA QPSVMDDIEV WLRTDLKGDD 
       460        470        480        490        500
LEEGVTSEEF DKFLEERAKA AEMVPDLPSP PMEAPAPASN PSGRKKPERS 

EDALFAL
Length:507
Mass (Da):55,556
Last modified:July 5, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6CB4B4433076D8D0
GO
Isoform 2 (identifier: Q6ZVM7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     73-122: Missing.

Note: No experimental confirmation available.
Show »
Length:457
Mass (Da):49,964
Checksum:i92D76584C342D6C8
GO
Isoform 3 (identifier: Q6ZVM7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     123-167: Missing.

Show »
Length:462
Mass (Da):50,509
Checksum:i0E8EE9521D76DAFB
GO
Isoform 4 (identifier: Q6ZVM7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-267: Missing.

Note: No experimental confirmation available.
Show »
Length:240
Mass (Da):26,136
Checksum:i82DE20A5B198F997
GO
Isoform 5 (identifier: Q6ZVM7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     168-220: Missing.
     426-426: G → GTFLSSAQKRGRGGESDLEPIDSWLITQGM

Note: No experimental confirmation available.
Show »
Length:483
Mass (Da):53,368
Checksum:i6C226EFFDDC0DF24
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B7Z2U2B7Z2U2_HUMAN
TOM1-like protein 2
TOM1L2
389Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H3S6F5H3S6_HUMAN
TOM1-like protein 2
TOM1L2
388Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ENB0K7ENB0_HUMAN
TOM1-like protein 2
TOM1L2
83Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EKL6K7EKL6_HUMAN
TOM1-like protein 2
TOM1L2
39Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAL78338 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti12P → A in AAL78338 (PubMed:11997338).Curated1
Sequence conflicti177T → S in AAL78338 (PubMed:11997338).Curated1
Sequence conflicti323N → S in AAL78338 (PubMed:11997338).Curated1
Sequence conflicti331I → L in AAL78338 (PubMed:11997338).Curated1
Sequence conflicti347N → S in AAL78338 (PubMed:11997338).Curated1
Sequence conflicti400K → Q in AAL78338 (PubMed:11997338).Curated1
Sequence conflicti466E → V in AAL78338 (PubMed:11997338).Curated1
Sequence conflicti475P → H in AAL78338 (PubMed:11997338).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0233901 – 267Missing in isoform 4. 1 PublicationAdd BLAST267
Alternative sequenceiVSP_02339173 – 122Missing in isoform 2. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_023392123 – 167Missing in isoform 3. 2 PublicationsAdd BLAST45
Alternative sequenceiVSP_057214168 – 220Missing in isoform 5. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_057215426G → GTFLSSAQKRGRGGESDLEP IDSWLITQGM in isoform 5. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF467441 mRNA Translation: AAL78338.1 Sequence problems.
AK057308 mRNA Translation: BAB71421.1
AK124331 mRNA Translation: BAC85834.1
AK294846 mRNA Translation: BAH11903.1
AK301944 mRNA Translation: BAH13590.1
AC087163 Genomic DNA No translation available.
AC122129 Genomic DNA No translation available.
KF456255 Genomic DNA No translation available.
BC051650 mRNA Translation: AAH51650.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS32584.1 [Q6ZVM7-2]
CCDS42270.1 [Q6ZVM7-1]
CCDS74002.1 [Q6ZVM7-3]
CCDS74003.1 [Q6ZVM7-5]

NCBI Reference Sequences

More...RefSeqi		NP_001028723.1, NM_001033551.2 [Q6ZVM7-2]
NP_001076437.1, NM_001082968.1 [Q6ZVM7-1]
NP_001275715.1, NM_001288786.1 [Q6ZVM7-5]
NP_001275716.1, NM_001288787.1 [Q6ZVM7-3]
NP_001275717.1, NM_001288788.1
NP_001275718.1, NM_001288789.1

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000318094; ENSP00000312860; ENSG00000175662 [Q6ZVM7-3]
ENST00000379504; ENSP00000368818; ENSG00000175662 [Q6ZVM7-1]
ENST00000395739; ENSP00000379088; ENSG00000175662 [Q6ZVM7-3]
ENST00000478943; ENSP00000463313; ENSG00000175662 [Q6ZVM7-4]
ENST00000535933; ENSP00000438621; ENSG00000175662 [Q6ZVM7-5]
ENST00000581396; ENSP00000464297; ENSG00000175662 [Q6ZVM7-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		146691

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:146691

UCSC genome browser

More...UCSCi		uc002gry.5 human [Q6ZVM7-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF467441 mRNA Translation: AAL78338.1 Sequence problems.
AK057308 mRNA Translation: BAB71421.1
AK124331 mRNA Translation: BAC85834.1
AK294846 mRNA Translation: BAH11903.1
AK301944 mRNA Translation: BAH13590.1
AC087163 Genomic DNA No translation available.
AC122129 Genomic DNA No translation available.
KF456255 Genomic DNA No translation available.
BC051650 mRNA Translation: AAH51650.1
CCDSiCCDS32584.1 [Q6ZVM7-2]
CCDS42270.1 [Q6ZVM7-1]
CCDS74002.1 [Q6ZVM7-3]
CCDS74003.1 [Q6ZVM7-5]
RefSeqiNP_001028723.1, NM_001033551.2 [Q6ZVM7-2]
NP_001076437.1, NM_001082968.1 [Q6ZVM7-1]
NP_001275715.1, NM_001288786.1 [Q6ZVM7-5]
NP_001275716.1, NM_001288787.1 [Q6ZVM7-3]
NP_001275717.1, NM_001288788.1
NP_001275718.1, NM_001288789.1

3D structure databases

SMRiQ6ZVM7
ModBaseiSearch...

Protein-protein interaction databases

BioGridi127001, 32 interactors
DIPiDIP-61860N
IntActiQ6ZVM7, 11 interactors
MINTiQ6ZVM7
STRINGi9606.ENSP00000368818

PTM databases

iPTMnetiQ6ZVM7
PhosphoSitePlusiQ6ZVM7

Polymorphism and mutation databases

BioMutaiTOM1L2
DMDMi74712301

Proteomic databases

EPDiQ6ZVM7
jPOSTiQ6ZVM7
MassIVEiQ6ZVM7
MaxQBiQ6ZVM7
PaxDbiQ6ZVM7
PeptideAtlasiQ6ZVM7
PRIDEiQ6ZVM7
ProteomicsDBi6447
68426 [Q6ZVM7-1]
68427 [Q6ZVM7-2]
68428 [Q6ZVM7-3]
68429 [Q6ZVM7-4]

Genome annotation databases

EnsembliENST00000318094; ENSP00000312860; ENSG00000175662 [Q6ZVM7-3]
ENST00000379504; ENSP00000368818; ENSG00000175662 [Q6ZVM7-1]
ENST00000395739; ENSP00000379088; ENSG00000175662 [Q6ZVM7-3]
ENST00000478943; ENSP00000463313; ENSG00000175662 [Q6ZVM7-4]
ENST00000535933; ENSP00000438621; ENSG00000175662 [Q6ZVM7-5]
ENST00000581396; ENSP00000464297; ENSG00000175662 [Q6ZVM7-2]
GeneIDi146691
KEGGihsa:146691
UCSCiuc002gry.5 human [Q6ZVM7-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		146691
DisGeNETi146691

GeneCards: human genes, protein and diseases

More...GeneCardsi		TOM1L2
HGNCiHGNC:11984 TOM1L2
HPAiHPA022541
HPA023304
MIMi615519 gene
neXtProtiNX_Q6ZVM7
OpenTargetsiENSG00000175662
PharmGKBiPA36668

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1087 Eukaryota
ENOG410Y26G LUCA
GeneTreeiENSGT00940000156940
HOGENOMiHOG000285970
InParanoidiQ6ZVM7
OMAiQAHLYRM
OrthoDBi1213216at2759
PhylomeDBiQ6ZVM7
TreeFamiTF314105

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		TOM1L2 human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		TOM1L2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		146691
PharosiQ6ZVM7
PMAP-CutDBiQ6ZVM7

Protein Ontology

More...PROi		PR:Q6ZVM7

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000175662 Expressed in 205 organ(s), highest expression level in heart left ventricle
ExpressionAtlasiQ6ZVM7 baseline and differential
GenevisibleiQ6ZVM7 HS

Family and domain databases

Gene3Di1.20.58.160, 1 hit
1.25.40.90, 1 hit
InterProiView protein in InterPro
IPR008942 ENTH_VHS
IPR004152 GAT_dom
IPR038425 GAT_sf
IPR014645 TOM1
IPR027429 TOM1L2
IPR002014 VHS_dom
PANTHERiPTHR13856:SF31 PTHR13856:SF31, 1 hit
PfamiView protein in Pfam
PF03127 GAT, 1 hit
PF00790 VHS, 1 hit
PIRSFiPIRSF036948 TOM1, 1 hit
SMARTiView protein in SMART
SM00288 VHS, 1 hit
SUPFAMiSSF48464 SSF48464, 1 hit
PROSITEiView protein in PROSITE
PS50909 GAT, 1 hit
PS50179 VHS, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTM1L2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6ZVM7
Secondary accession number(s): B7Z2L7
, B7Z7F4, Q86V61, Q8TDE7, Q96M88
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 20, 2007
Last sequence update: July 5, 2004
Last modified: October 16, 2019
This is version 133 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again