Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

TOM1-like protein 2

Gene

TOM1L2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Probable role in protein transport. May regulate growth factor-induced mitogenic signaling.2 Publications

GO - Molecular functioni

  • clathrin binding Source: UniProtKB
  • protein kinase binding Source: UniProtKB

GO - Biological processi

Keywordsi

Biological processProtein transport, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
TOM1-like protein 2
Alternative name(s):
Target of Myb-like protein 2
Gene namesi
Name:TOM1L2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

EuPathDBiHostDB:ENSG00000175662.17
HGNCiHGNC:11984 TOM1L2
MIMi615519 gene
neXtProtiNX_Q6ZVM7

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

DisGeNETi146691
OpenTargetsiENSG00000175662
PharmGKBiPA36668

Polymorphism and mutation databases

BioMutaiTOM1L2
DMDMi74712301

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002787901 – 507TOM1-like protein 2Add BLAST507

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei160PhosphoserineCombined sources1
Modified residuei164PhosphothreonineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ6ZVM7
MaxQBiQ6ZVM7
PaxDbiQ6ZVM7
PeptideAtlasiQ6ZVM7
PRIDEiQ6ZVM7
ProteomicsDBi68426
68427 [Q6ZVM7-2]
68428 [Q6ZVM7-3]
68429 [Q6ZVM7-4]

PTM databases

iPTMnetiQ6ZVM7
PhosphoSitePlusiQ6ZVM7

Miscellaneous databases

PMAP-CutDBiQ6ZVM7

Expressioni

Tissue specificityi

Ubiquitously expressed with higher expression in heart and skeletal muscle.1 Publication

Gene expression databases

BgeeiENSG00000175662 Expressed in 205 organ(s), highest expression level in heart left ventricle
CleanExiHS_TOM1L2
ExpressionAtlasiQ6ZVM7 baseline and differential
GenevisibleiQ6ZVM7 HS

Organism-specific databases

HPAiHPA022541
HPA023304

Interactioni

Subunit structurei

Interacts with clathrin, SRC and TOLLIP.2 Publications

GO - Molecular functioni

Protein-protein interaction databases

BioGridi127001, 30 interactors
DIPiDIP-61860N
IntActiQ6ZVM7, 7 interactors
MINTiQ6ZVM7
STRINGi9606.ENSP00000368818

Structurei

3D structure databases

ProteinModelPortaliQ6ZVM7
SMRiQ6ZVM7
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini20 – 152VHSPROSITE-ProRule annotationAdd BLAST133
Domaini219 – 307GATPROSITE-ProRule annotationAdd BLAST89

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi329 – 334Clathrin-binding6

Domaini

The GAT domain mediates interaction with TOLLIP.

Sequence similaritiesi

Belongs to the TOM1 family.Curated

Phylogenomic databases

eggNOGiKOG1087 Eukaryota
ENOG410Y26G LUCA
GeneTreeiENSGT00930000150885
HOGENOMiHOG000285970
HOVERGENiHBG025068
InParanoidiQ6ZVM7
OMAiQRKNVKY
OrthoDBiEOG091G08M1
PhylomeDBiQ6ZVM7
TreeFamiTF314105

Family and domain databases

Gene3Di1.20.58.160, 1 hit
1.25.40.90, 1 hit
InterProiView protein in InterPro
IPR008942 ENTH_VHS
IPR004152 GAT_dom
IPR038425 GAT_sf
IPR014645 TOM1
IPR027429 TOM1L2
IPR002014 VHS_dom
PANTHERiPTHR13856:SF31 PTHR13856:SF31, 1 hit
PfamiView protein in Pfam
PF03127 GAT, 1 hit
PF00790 VHS, 1 hit
PIRSFiPIRSF036948 TOM1, 1 hit
SMARTiView protein in SMART
SM00288 VHS, 1 hit
SUPFAMiSSF48464 SSF48464, 1 hit
PROSITEiView protein in PROSITE
PS50909 GAT, 1 hit
PS50179 VHS, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6ZVM7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEFLLGNPFS TPVGQCLEKA TDGSLQSEDW TLNMEICDII NETEEGPKDA
60 70 80 90 100
IRALKKRLNG NRNYREVMLA LTVLETCVKN CGHRFHILVA NRDFIDSVLV
110 120 130 140 150
KIISPKNNPP TIVQDKVLAL IQAWADAFRS SPDLTGVVHI YEELKRKGVE
160 170 180 190 200
FPMADLDALS PIHTPQRSVP EVDPAATMPR SQSQQRTSAG SYSSPPPAPY
210 220 230 240 250
SAPQAPALSV TGPITANSEQ IARLRSELDV VRGNTKVMSE MLTEMVPGQE
260 270 280 290 300
DSSDLELLQE LNRTCRAMQQ RIVELISRVS NEEVTEELLH VNDDLNNVFL
310 320 330 340 350
RYERFERYRS GRSVQNASNG VLNEVTEDNL IDLGPGSPAV VSPMVGNTAP
360 370 380 390 400
PSSLSSQLAG LDLGTESVSG TLSSLQQCNP RDGFDMFAQT RGNSLAEQRK
410 420 430 440 450
TVTYEDPQAV GGLASALDNR KQSSEGIPVA QPSVMDDIEV WLRTDLKGDD
460 470 480 490 500
LEEGVTSEEF DKFLEERAKA AEMVPDLPSP PMEAPAPASN PSGRKKPERS

EDALFAL
Length:507
Mass (Da):55,556
Last modified:July 5, 2004 - v1
Checksum:i6CB4B4433076D8D0
GO
Isoform 2 (identifier: Q6ZVM7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     73-122: Missing.

Note: No experimental confirmation available.
Show »
Length:457
Mass (Da):49,964
Checksum:i92D76584C342D6C8
GO
Isoform 3 (identifier: Q6ZVM7-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     123-167: Missing.

Show »
Length:462
Mass (Da):50,509
Checksum:i0E8EE9521D76DAFB
GO
Isoform 4 (identifier: Q6ZVM7-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-267: Missing.

Note: No experimental confirmation available.
Show »
Length:240
Mass (Da):26,136
Checksum:i82DE20A5B198F997
GO
Isoform 5 (identifier: Q6ZVM7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     168-220: Missing.
     426-426: G → GTFLSSAQKRGRGGESDLEPIDSWLITQGM

Note: No experimental confirmation available.
Show »
Length:483
Mass (Da):53,368
Checksum:i6C226EFFDDC0DF24
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
B7Z2U2B7Z2U2_HUMAN
TOM1-like protein 2
TOM1L2
389Annotation score:
F5H3S6F5H3S6_HUMAN
TOM1-like protein 2
TOM1L2
388Annotation score:
K7ENB0K7ENB0_HUMAN
TOM1-like protein 2
TOM1L2
83Annotation score:
K7EKL6K7EKL6_HUMAN
TOM1-like protein 2
TOM1L2
39Annotation score:

Sequence cautioni

The sequence AAL78338 differs from that shown. Reason: Frameshift at positions 101, 121 and 170.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti12P → A in AAL78338 (PubMed:11997338).Curated1
Sequence conflicti177T → S in AAL78338 (PubMed:11997338).Curated1
Sequence conflicti323N → S in AAL78338 (PubMed:11997338).Curated1
Sequence conflicti331I → L in AAL78338 (PubMed:11997338).Curated1
Sequence conflicti347N → S in AAL78338 (PubMed:11997338).Curated1
Sequence conflicti400K → Q in AAL78338 (PubMed:11997338).Curated1
Sequence conflicti466E → V in AAL78338 (PubMed:11997338).Curated1
Sequence conflicti475P → H in AAL78338 (PubMed:11997338).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0233901 – 267Missing in isoform 4. 1 PublicationAdd BLAST267
Alternative sequenceiVSP_02339173 – 122Missing in isoform 2. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_023392123 – 167Missing in isoform 3. 2 PublicationsAdd BLAST45
Alternative sequenceiVSP_057214168 – 220Missing in isoform 5. 1 PublicationAdd BLAST53
Alternative sequenceiVSP_057215426G → GTFLSSAQKRGRGGESDLEP IDSWLITQGM in isoform 5. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF467441 mRNA Translation: AAL78338.1 Sequence problems.
AK057308 mRNA Translation: BAB71421.1
AK124331 mRNA Translation: BAC85834.1
AK294846 mRNA Translation: BAH11903.1
AK301944 mRNA Translation: BAH13590.1
AC087163 Genomic DNA No translation available.
AC122129 Genomic DNA No translation available.
KF456255 Genomic DNA No translation available.
BC051650 mRNA Translation: AAH51650.1
CCDSiCCDS32584.1 [Q6ZVM7-2]
CCDS42270.1 [Q6ZVM7-1]
CCDS74002.1 [Q6ZVM7-3]
CCDS74003.1 [Q6ZVM7-5]
RefSeqiNP_001028723.1, NM_001033551.2 [Q6ZVM7-2]
NP_001076437.1, NM_001082968.1 [Q6ZVM7-1]
NP_001275715.1, NM_001288786.1 [Q6ZVM7-5]
NP_001275716.1, NM_001288787.1 [Q6ZVM7-3]
NP_001275717.1, NM_001288788.1
NP_001275718.1, NM_001288789.1
UniGeneiHs.462379

Genome annotation databases

EnsembliENST00000318094; ENSP00000312860; ENSG00000175662 [Q6ZVM7-3]
ENST00000379504; ENSP00000368818; ENSG00000175662 [Q6ZVM7-1]
ENST00000395739; ENSP00000379088; ENSG00000175662 [Q6ZVM7-3]
ENST00000478943; ENSP00000463313; ENSG00000175662 [Q6ZVM7-4]
ENST00000535933; ENSP00000438621; ENSG00000175662 [Q6ZVM7-5]
ENST00000581396; ENSP00000464297; ENSG00000175662 [Q6ZVM7-2]
GeneIDi146691
KEGGihsa:146691
UCSCiuc002gry.5 human [Q6ZVM7-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF467441 mRNA Translation: AAL78338.1 Sequence problems.
AK057308 mRNA Translation: BAB71421.1
AK124331 mRNA Translation: BAC85834.1
AK294846 mRNA Translation: BAH11903.1
AK301944 mRNA Translation: BAH13590.1
AC087163 Genomic DNA No translation available.
AC122129 Genomic DNA No translation available.
KF456255 Genomic DNA No translation available.
BC051650 mRNA Translation: AAH51650.1
CCDSiCCDS32584.1 [Q6ZVM7-2]
CCDS42270.1 [Q6ZVM7-1]
CCDS74002.1 [Q6ZVM7-3]
CCDS74003.1 [Q6ZVM7-5]
RefSeqiNP_001028723.1, NM_001033551.2 [Q6ZVM7-2]
NP_001076437.1, NM_001082968.1 [Q6ZVM7-1]
NP_001275715.1, NM_001288786.1 [Q6ZVM7-5]
NP_001275716.1, NM_001288787.1 [Q6ZVM7-3]
NP_001275717.1, NM_001288788.1
NP_001275718.1, NM_001288789.1
UniGeneiHs.462379

3D structure databases

ProteinModelPortaliQ6ZVM7
SMRiQ6ZVM7
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127001, 30 interactors
DIPiDIP-61860N
IntActiQ6ZVM7, 7 interactors
MINTiQ6ZVM7
STRINGi9606.ENSP00000368818

PTM databases

iPTMnetiQ6ZVM7
PhosphoSitePlusiQ6ZVM7

Polymorphism and mutation databases

BioMutaiTOM1L2
DMDMi74712301

Proteomic databases

EPDiQ6ZVM7
MaxQBiQ6ZVM7
PaxDbiQ6ZVM7
PeptideAtlasiQ6ZVM7
PRIDEiQ6ZVM7
ProteomicsDBi68426
68427 [Q6ZVM7-2]
68428 [Q6ZVM7-3]
68429 [Q6ZVM7-4]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000318094; ENSP00000312860; ENSG00000175662 [Q6ZVM7-3]
ENST00000379504; ENSP00000368818; ENSG00000175662 [Q6ZVM7-1]
ENST00000395739; ENSP00000379088; ENSG00000175662 [Q6ZVM7-3]
ENST00000478943; ENSP00000463313; ENSG00000175662 [Q6ZVM7-4]
ENST00000535933; ENSP00000438621; ENSG00000175662 [Q6ZVM7-5]
ENST00000581396; ENSP00000464297; ENSG00000175662 [Q6ZVM7-2]
GeneIDi146691
KEGGihsa:146691
UCSCiuc002gry.5 human [Q6ZVM7-1]

Organism-specific databases

CTDi146691
DisGeNETi146691
EuPathDBiHostDB:ENSG00000175662.17
GeneCardsiTOM1L2
HGNCiHGNC:11984 TOM1L2
HPAiHPA022541
HPA023304
MIMi615519 gene
neXtProtiNX_Q6ZVM7
OpenTargetsiENSG00000175662
PharmGKBiPA36668
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1087 Eukaryota
ENOG410Y26G LUCA
GeneTreeiENSGT00930000150885
HOGENOMiHOG000285970
HOVERGENiHBG025068
InParanoidiQ6ZVM7
OMAiQRKNVKY
OrthoDBiEOG091G08M1
PhylomeDBiQ6ZVM7
TreeFamiTF314105

Miscellaneous databases

ChiTaRSiTOM1L2 human
GeneWikiiTOM1L2
GenomeRNAii146691
PMAP-CutDBiQ6ZVM7
PROiPR:Q6ZVM7
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000175662 Expressed in 205 organ(s), highest expression level in heart left ventricle
CleanExiHS_TOM1L2
ExpressionAtlasiQ6ZVM7 baseline and differential
GenevisibleiQ6ZVM7 HS

Family and domain databases

Gene3Di1.20.58.160, 1 hit
1.25.40.90, 1 hit
InterProiView protein in InterPro
IPR008942 ENTH_VHS
IPR004152 GAT_dom
IPR038425 GAT_sf
IPR014645 TOM1
IPR027429 TOM1L2
IPR002014 VHS_dom
PANTHERiPTHR13856:SF31 PTHR13856:SF31, 1 hit
PfamiView protein in Pfam
PF03127 GAT, 1 hit
PF00790 VHS, 1 hit
PIRSFiPIRSF036948 TOM1, 1 hit
SMARTiView protein in SMART
SM00288 VHS, 1 hit
SUPFAMiSSF48464 SSF48464, 1 hit
PROSITEiView protein in PROSITE
PS50909 GAT, 1 hit
PS50179 VHS, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiTM1L2_HUMAN
AccessioniPrimary (citable) accession number: Q6ZVM7
Secondary accession number(s): B7Z2L7
, B7Z7F4, Q86V61, Q8TDE7, Q96M88
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 20, 2007
Last sequence update: July 5, 2004
Last modified: November 7, 2018
This is version 126 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again