Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

LanC-like protein 3

Gene

LANCL3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

GO - Molecular functioni

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
LanC-like protein 3
Gene namesi
Name:LANCL3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

EuPathDBiHostDB:ENSG00000147036.11
HGNCiHGNC:24767 LANCL3
neXtProtiNX_Q6ZV70

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000147036
PharmGKBiPA134879796

Polymorphism and mutation databases

BioMutaiLANCL3
DMDMi146324960

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002852511 – 420LanC-like protein 3Add BLAST420

Proteomic databases

MaxQBiQ6ZV70
PaxDbiQ6ZV70
PeptideAtlasiQ6ZV70
PRIDEiQ6ZV70
ProteomicsDBi68395
68396 [Q6ZV70-2]

PTM databases

iPTMnetiQ6ZV70
PhosphoSitePlusiQ6ZV70

Expressioni

Gene expression databases

BgeeiENSG00000147036
CleanExiHS_LANCL3
GenevisibleiQ6ZV70 HS

Organism-specific databases

HPAiHPA005470
HPA076575

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000367882

Structurei

3D structure databases

ProteinModelPortaliQ6ZV70
SMRiQ6ZV70
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the LanC-like protein family.Curated

Phylogenomic databases

eggNOGiKOG2787 Eukaryota
ENOG410XQIA LUCA
GeneTreeiENSGT00530000063186
HOGENOMiHOG000240926
HOVERGENiHBG094983
InParanoidiQ6ZV70
OMAiLPLMYQY
OrthoDBiEOG091G02TS
PhylomeDBiQ6ZV70
TreeFamiTF300068

Family and domain databases

CDDicd04794 euk_LANCL, 1 hit
Gene3Di1.50.10.10, 1 hit
InterProiView protein in InterPro
IPR012341 6hp_glycosidase-like_sf
IPR007822 LANC-like
IPR020464 LanC-like_prot_euk
PfamiView protein in Pfam
PF05147 LANC_like, 1 hit
PRINTSiPR01951 LANCEUKARYTE
PR01950 LANCSUPER
SMARTiView protein in SMART
SM01260 LANC_like, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6ZV70-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDTKRCFANR FDDYQGSLLA GQCEEAVAPL VTATIERILQ ELPPLGGGAE
60 70 80 90 100
ARGATAGASA CQGGLYGGVA GVAYMLYHVS QSPLFATARE RYLRSAKRLI
110 120 130 140 150
DACARAEEWG EPDADTRAAF LLGGAGVYAV ATLVYHALGR SDYVQPLGKF
160 170 180 190 200
RALCAVCAPV SFLECGSDEL FVGRAGYLCA ALVLKQKLAQ EVLTPAQIKS
210 220 230 240 250
ICQAILDSGK QYAIKKRKPF PLMYSYYGTE YLGAAHGLSS ILQMLLSYHE
260 270 280 290 300
HLKPSDRELV WQSVDFLMEQ EQNCNWPPEL GETIERENEL VHWCHGAPGI
310 320 330 340 350
AYLFAKAYLV SKKPQYLDTC IRCGELTWQK GLLKKGPGIC HGVAGSAYVF
360 370 380 390 400
LLLYRLTGNS KYIYRAQRFA QFLFTEEFKA GSRVLESIYS LYEGFSGTVC
410 420
FLIDLLQPNQ AEFPLFSVFV
Length:420
Mass (Da):46,319
Last modified:May 1, 2007 - v2
Checksum:iEB5A966DE8784468
GO
Isoform 2 (identifier: Q6ZV70-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     368-420: RFAQFLFTEEFKAGSRVLESIYSLYEGFSGTVCFLIDLLQPNQAEFPLFSVFV → SSFPVNLIKMEHLLYTRQHCF

Show »
Length:388
Mass (Da):42,780
Checksum:iC341A77B6F63AFA6
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_024855368 – 420RFAQF…FSVFV → SSFPVNLIKMEHLLYTRQHC F in isoform 2. 2 PublicationsAdd BLAST53

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK124915 mRNA Translation: BAC85993.1
AL627244 Genomic DNA No translation available.
AL121577 Genomic DNA No translation available.
BC093667 mRNA Translation: AAH93667.1
BC093669 mRNA Translation: AAH93669.1
CCDSiCCDS14240.1 [Q6ZV70-2]
CCDS55398.1 [Q6ZV70-1]
RefSeqiNP_001163802.1, NM_001170331.1 [Q6ZV70-1]
NP_940913.1, NM_198511.2 [Q6ZV70-2]
UniGeneiHs.521932

Genome annotation databases

EnsembliENST00000378619; ENSP00000367882; ENSG00000147036 [Q6ZV70-1]
ENST00000378621; ENSP00000367885; ENSG00000147036 [Q6ZV70-2]
ENST00000614025; ENSP00000479231; ENSG00000147036 [Q6ZV70-2]
GeneIDi347404
KEGGihsa:347404
UCSCiuc004ddp.3 human [Q6ZV70-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiLANC3_HUMAN
AccessioniPrimary (citable) accession number: Q6ZV70
Secondary accession number(s): A6NHE3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 2007
Last sequence update: May 1, 2007
Last modified: June 20, 2018
This is version 102 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health