Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 107 (10 Feb 2021)
Sequence version 3 (05 Apr 2011)
Previous versions | rss
Add a publicationFeedback
Protein

Protein FAM47E

Gene

FAM47E

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q6ZV65

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein FAM47E
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:FAM47E
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:34343, FAM47E

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6ZV65

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000189157.13

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
100129583
100631383

Open Targets

More...
OpenTargetsi
ENSG00000189157
ENSG00000272414

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q6ZV65, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FAM47E

Domain mapping of disease mutations (DMDM)

More...
DMDMi
327478584

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003260741 – 393Protein FAM47EAdd BLAST393

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6ZV65

PeptideAtlas

More...
PeptideAtlasi
Q6ZV65

PRoteomics IDEntifications database

More...
PRIDEi
Q6ZV65

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
68392 [Q6ZV65-3]
68393 [Q6ZV65-1]
68394 [Q6ZV65-2]

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000189157, Expressed in right uterine tube and 117 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6ZV65, baseline and differential

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000189157, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
1530105, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000409423

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q6ZV65, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili326 – 354Sequence analysisAdd BLAST29

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the FAM47 family.Curated

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QRUF, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162425

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_092258_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6ZV65

Identification of Orthologs from Complete Genome Data

More...
OMAi
CKAQDEN

Database of Orthologous Groups

More...
OrthoDBi
678383at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6ZV65

TreeFam database of animal gene trees

More...
TreeFami
TF340932

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR032743, FAM47

The PANTHER Classification System

More...
PANTHERi
PTHR46449, PTHR46449, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF14642, FAM47, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6ZV65-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MADRRRRLRP GTLAPVREGV NCRSRCFTKH KNGLKFPTSL HSRQLVFPRK
60 70 80 90 100
GLDDFRKGCP PCTGLVTQVP VEGFLPQIYH RAPQLAPKKR QIKLLKEADV
110 120 130 140 150
LSKLSPAQQA RKAFLEDVEA HLTPHPLALY LNLEEAMPIE LLSKVLEVLD
160 170 180 190 200
PDRKLEDTWA YCQDTRKGMK EPTKLLKKHS TQVYLGPSKK TSVSNAGQWL
210 220 230 240 250
YEEKPHKMDL LHENGPRPGL HENGISDIDE EFILKQFDID YETKPSHDAL
260 270 280 290 300
HTMKLNQVPL ELKRSVGLSK LQETEFFQKL GYERKLQKPQ NPYKPKWVKM
310 320 330 340 350
RYGAWYLNPK LWKKQRVDEP LVDPEVSHKA QEENFKKELQ EQEELLADLH
360 370 380 390
GTVAFKDFIL SRGYRTPRFL ENMYIGKECK RACNKTPIKR TQA
Length:393
Mass (Da):45,662
Last modified:April 5, 2011 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i0945D3CDA7B471F8
GO
Isoform 2 (identifier: Q6ZV65-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-113: Missing.
     114-140: FLEDVEAHLTPHPLALYLNLEEAMPIE → MQMSVPCVLSSLQNHEPNKPLFTTQSQ
     223-223: N → NVCKAVSDFCKWVTTF

Show »
Length:295
Mass (Da):34,526
Checksum:iFB51DE1D9CAA904D
GO
Isoform 3 (identifier: Q6ZV65-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     343-393: EELLADLHGTVAFKDFILSRGYRTPRFLENMYIGKECKRACNKTPIKRTQA → SIFKKAMDI

Show »
Length:351
Mass (Da):40,783
Checksum:iCF13DA4119C9989A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RBT2D6RBT2_HUMAN
Protein FAM47E
FAM47E
133Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
U3KQR7U3KQR7_HUMAN
Protein FAM47E
FAM47E
124Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GUL4A0A1B0GUL4_HUMAN
Protein FAM47E
FAM47E
181Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GTQ8A0A1B0GTQ8_HUMAN
Protein FAM47E
FAM47E
129Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti273E → K in BAC85998 (PubMed:14702039).Curated1
Sequence conflicti366T → M in BAC85998 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0409311 – 113Missing in isoform 2. 1 PublicationAdd BLAST113
Alternative sequenceiVSP_040932114 – 140FLEDV…AMPIE → MQMSVPCVLSSLQNHEPNKP LFTTQSQ in isoform 2. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_040933223N → NVCKAVSDFCKWVTTF in isoform 2. 1 Publication1
Alternative sequenceiVSP_040934343 – 393EELLA…KRTQA → SIFKKAMDI in isoform 3. 1 PublicationAdd BLAST51

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK092277 mRNA No translation available.
AK124936 mRNA Translation: BAC85998.1
CR591456 mRNA No translation available.
AC034139 Genomic DNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS47081.1 [Q6ZV65-3]
CCDS58907.1 [Q6ZV65-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001130042.1, NM_001136570.2 [Q6ZV65-3]
NP_001229865.1, NM_001242936.1 [Q6ZV65-2]
NP_001229868.1, NM_001242939.1 [Q6ZV65-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000424749; ENSP00000409423; ENSG00000189157 [Q6ZV65-3]
ENST00000510197; ENSP00000422262; ENSG00000189157 [Q6ZV65-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
100129583
100631383

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:100129583
hsa:100631383

UCSC genome browser

More...
UCSCi
uc003hjv.4, human [Q6ZV65-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK092277 mRNA No translation available.
AK124936 mRNA Translation: BAC85998.1
CR591456 mRNA No translation available.
AC034139 Genomic DNA No translation available.
CCDSiCCDS47081.1 [Q6ZV65-3]
CCDS58907.1 [Q6ZV65-2]
RefSeqiNP_001130042.1, NM_001136570.2 [Q6ZV65-3]
NP_001229865.1, NM_001242936.1 [Q6ZV65-2]
NP_001229868.1, NM_001242939.1 [Q6ZV65-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi1530105, 2 interactors
STRINGi9606.ENSP00000409423

Genetic variation databases

BioMutaiFAM47E
DMDMi327478584

Proteomic databases

PaxDbiQ6ZV65
PeptideAtlasiQ6ZV65
PRIDEiQ6ZV65
ProteomicsDBi68392 [Q6ZV65-3]
68393 [Q6ZV65-1]
68394 [Q6ZV65-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
64546, 34 antibodies

Genome annotation databases

EnsembliENST00000424749; ENSP00000409423; ENSG00000189157 [Q6ZV65-3]
ENST00000510197; ENSP00000422262; ENSG00000189157 [Q6ZV65-2]
GeneIDi100129583
100631383
KEGGihsa:100129583
hsa:100631383
UCSCiuc003hjv.4, human [Q6ZV65-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
100129583
100631383
DisGeNETi100129583
100631383

GeneCards: human genes, protein and diseases

More...
GeneCardsi
FAM47E
HGNCiHGNC:34343, FAM47E
HPAiENSG00000189157, Low tissue specificity
neXtProtiNX_Q6ZV65
OpenTargetsiENSG00000189157
ENSG00000272414
VEuPathDBiHostDB:ENSG00000189157.13

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502QRUF, Eukaryota
GeneTreeiENSGT00940000162425
HOGENOMiCLU_092258_0_0_1
InParanoidiQ6ZV65
OMAiCKAQDEN
OrthoDBi678383at2759
PhylomeDBiQ6ZV65
TreeFamiTF340932

Enzyme and pathway databases

PathwayCommonsiQ6ZV65

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
100129583, 3 hits in 875 CRISPR screens
100631383, 3 hits in 799 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
FAM47E, human
PharosiQ6ZV65, Tdark

Protein Ontology

More...
PROi
PR:Q6ZV65
RNActiQ6ZV65, protein

Gene expression databases

BgeeiENSG00000189157, Expressed in right uterine tube and 117 other tissues
ExpressionAtlasiQ6ZV65, baseline and differential

Family and domain databases

InterProiView protein in InterPro
IPR032743, FAM47
PANTHERiPTHR46449, PTHR46449, 1 hit
PfamiView protein in Pfam
PF14642, FAM47, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiFA47E_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6ZV65
Secondary accession number(s): D6R8Y4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: April 5, 2011
Last modified: February 10, 2021
This is version 107 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again