Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q6ZUS6 (CC149_HUMAN)

Entry version 98 (31 Jul 2019)
Sequence version 2 (22 Jul 2008)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Coiled-coil domain-containing protein 149

Gene

CCDC149

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Coiled-coil domain-containing protein 149
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CCDC149
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:25405 CCDC149

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q6ZUS6

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		91050

Open Targets

More...OpenTargetsi		ENSG00000181982

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA162381560

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CCDC149

Domain mapping of disease mutations (DMDM)

More...DMDMi		205371874

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003442091 – 474Coiled-coil domain-containing protein 149Add BLAST474

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...jPOSTi		Q6ZUS6

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q6ZUS6

PeptideAtlas

More...PeptideAtlasi		Q6ZUS6

PRoteomics IDEntifications database

More...PRIDEi		Q6ZUS6

ProteomicsDB human proteome resource

More...ProteomicsDBi		68349 [Q6ZUS6-1]
68350 [Q6ZUS6-2]
68351 [Q6ZUS6-3]
68352 [Q6ZUS6-4]
68353 [Q6ZUS6-5]
68354 [Q6ZUS6-6]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q6ZUS6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q6ZUS6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000181982 Expressed in 171 organ(s), highest expression level in parotid gland

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q6ZUS6 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q6ZUS6 HS

Organism-specific databases

Human Protein Atlas

More...HPAi		HPA044158
HPA047913

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...BioGridi		124790, 4 interactors

Protein interaction database and analysis system

More...IntActi		Q6ZUS6, 3 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000425715

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q6ZUS6

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili1 – 199Sequence analysisAdd BLAST199
Coiled coili259 – 286Sequence analysisAdd BLAST28
Coiled coili385 – 414Sequence analysisAdd BLAST30

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi205 – 208Poly-Ser4

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CCDC149 family.Curated

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG4687 Eukaryota
ENOG410ZRJ8 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00390000015958

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		HOG000015087

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q6ZUS6

Database of Orthologous Groups

More...OrthoDBi		697466at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q6ZUS6

TreeFam database of animal gene trees

More...TreeFami		TF319794

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR019179 Coiled-coil_dom-contain_pr_149

The PANTHER Classification System

More...PANTHERi		PTHR21682 PTHR21682, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF09789 DUF2353, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6ZUS6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MANQLRERHQ SLKKKYRELI DGDPSLPPEK RKQANLAQLL RDSQDRNKHL 
        60         70         80         90        100
GEEIKELQQR LGEVQGDNKL LRMTIAKQRL GDEAIGVRHF AAHEREDLVQ 
       110        120        130        140        150
QLERAKEQIE SLEHDLQASV DELQDVKEER SSYQDKVERL NQELNHILSG 
       160        170        180        190        200
HENRIIDVDA LCMENRYLQE RLKQLHEEVN LLKSNIAKYK NALERRKNSK 
       210        220        230        240        250
GQGKSSSSAL TGVLSAKQVQ DLLSEDHGCS LPATPQSISD LKSLATALLE 
       260        270        280        290        300
TIHEKNMVIQ HQRQTNKILG NRVAELEKKL RTLEVSGLWS LPGGKDTILF 
       310        320        330        340        350
SDPTLPSGQR SRSPLLKFVE QPTENKADPK DGEAQKQEED ESCAAAEALT 
       360        370        380        390        400
APEDAGRPAV NSPANQSRGN QCKLFHPSLP QLPSEEEVNS LGREIIKLTK 
       410        420        430        440        450
EQAAAELEEV RRESPIEGQR SETGPAPPGL AIQGELPKSH LDSFEASRPA 
       460        470 
AKASTPEDGK GIPEGGGMRS TVKT
Length:474
Mass (Da):52,796
Last modified:July 22, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iFCB0B1188A9634C2
GO
Isoform 2 (identifier: Q6ZUS6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEEEAMNGDRTESDWQGLVSEYLVCKRKLESKKEALLILSKELDTCQQERDQYKLM
     268-474: Missing.

Note: No experimental confirmation available.
Show »
Length:322
Mass (Da):37,183
Checksum:i0614FC7F8D98448D
GO
Isoform 3 (identifier: Q6ZUS6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEEEAMNGDRTESDWQGLVSEYLVCKRKLESKKEALLILSKELDTCQQERDQYKLM
     70-86: LLRMTIAKQRLGDEAIG → GRLRSKKKMKVVPLLRR
     87-474: Missing.

Note: No experimental confirmation available.
Show »
Length:141
Mass (Da):16,656
Checksum:i5FCF7B568A791171
GO
Isoform 4 (identifier: Q6ZUS6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MEEEAMNGDRTESDWQGLVSEYLVCKRKLESKKEALLILSKELDTCQQERDQYKLM

Show »
Length:529
Mass (Da):59,288
Checksum:i395C9DD2C4A49AD6
GO
Isoform 5 (identifier: Q6ZUS6-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MVVIVVVIIIIIARAATWDSEYLVCKRKLESKKEALLILSKELDTCQQERDQYKLM

Show »
Length:529
Mass (Da):59,186
Checksum:i0633048BBF0ACA61
GO
Isoform 6 (identifier: Q6ZUS6-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-72: Missing.

Show »
Length:402
Mass (Da):44,315
Checksum:i47D20796615379A6
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0U1RQD2A0A0U1RQD2_HUMAN
Coiled-coil domain-containing prote...
CCDC149
540Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH57761 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAH67735 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAC86142 differs from that shown. Reason: Frameshift at position 30.Curated
The sequence BAC86142 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti196R → Q in BAG64075 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0425001 – 72Missing in isoform 6. 1 PublicationAdd BLAST72
Alternative sequenceiVSP_0424981M → MEEEAMNGDRTESDWQGLVS EYLVCKRKLESKKEALLILS KELDTCQQERDQYKLM in isoform 2, isoform 3 and isoform 4. 2 Publications1
Alternative sequenceiVSP_0424991M → MVVIVVVIIIIIARAATWDS EYLVCKRKLESKKEALLILS KELDTCQQERDQYKLM in isoform 5. 1 Publication1
Alternative sequenceiVSP_03474170 – 86LLRMT…DEAIG → GRLRSKKKMKVVPLLRR in isoform 3. 1 PublicationAdd BLAST17
Alternative sequenceiVSP_03474287 – 474Missing in isoform 3. 1 PublicationAdd BLAST388
Alternative sequenceiVSP_034743268 – 474Missing in isoform 2. 1 PublicationAdd BLAST207

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK125353 mRNA Translation: BAC86142.1 Sequence problems.
AK296454 mRNA Translation: BAG59102.1
AK302905 mRNA Translation: BAG64075.1
AL834257 mRNA Translation: CAD38932.1
AC006390 Genomic DNA No translation available.
AC113614 Genomic DNA No translation available.
AC116422 Genomic DNA No translation available.
CH471069 Genomic DNA Translation: EAW92824.1
CH471069 Genomic DNA Translation: EAW92825.1
BC067735 mRNA Translation: AAH67735.1 Different initiation.
BC057761 mRNA Translation: AAH57761.1 Different initiation.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS33967.2 [Q6ZUS6-5]
CCDS47036.1 [Q6ZUS6-4]

NCBI Reference Sequences

More...RefSeqi		NP_001124198.1, NM_001130726.3 [Q6ZUS6-4]
NP_001317572.1, NM_001330643.1
NP_001317573.1, NM_001330644.1 [Q6ZUS6-1]
NP_775734.2, NM_173463.5 [Q6ZUS6-5]
XP_016864316.1, XM_017008827.1 [Q6ZUS6-5]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000389609; ENSP00000374260; ENSG00000181982 [Q6ZUS6-5]
ENST00000502801; ENSP00000427529; ENSG00000181982 [Q6ZUS6-3]
ENST00000504487; ENSP00000425715; ENSG00000181982 [Q6ZUS6-4]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		91050

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:91050

UCSC genome browser

More...UCSCi		uc003grc.4 human [Q6ZUS6-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK125353 mRNA Translation: BAC86142.1 Sequence problems.
AK296454 mRNA Translation: BAG59102.1
AK302905 mRNA Translation: BAG64075.1
AL834257 mRNA Translation: CAD38932.1
AC006390 Genomic DNA No translation available.
AC113614 Genomic DNA No translation available.
AC116422 Genomic DNA No translation available.
CH471069 Genomic DNA Translation: EAW92824.1
CH471069 Genomic DNA Translation: EAW92825.1
BC067735 mRNA Translation: AAH67735.1 Different initiation.
BC057761 mRNA Translation: AAH57761.1 Different initiation.
CCDSiCCDS33967.2 [Q6ZUS6-5]
CCDS47036.1 [Q6ZUS6-4]
RefSeqiNP_001124198.1, NM_001130726.3 [Q6ZUS6-4]
NP_001317572.1, NM_001330643.1
NP_001317573.1, NM_001330644.1 [Q6ZUS6-1]
NP_775734.2, NM_173463.5 [Q6ZUS6-5]
XP_016864316.1, XM_017008827.1 [Q6ZUS6-5]

3D structure databases

SMRiQ6ZUS6
ModBaseiSearch...

Protein-protein interaction databases

BioGridi124790, 4 interactors
IntActiQ6ZUS6, 3 interactors
STRINGi9606.ENSP00000425715

PTM databases

iPTMnetiQ6ZUS6
PhosphoSitePlusiQ6ZUS6

Polymorphism and mutation databases

BioMutaiCCDC149
DMDMi205371874

Proteomic databases

jPOSTiQ6ZUS6
PaxDbiQ6ZUS6
PeptideAtlasiQ6ZUS6
PRIDEiQ6ZUS6
ProteomicsDBi68349 [Q6ZUS6-1]
68350 [Q6ZUS6-2]
68351 [Q6ZUS6-3]
68352 [Q6ZUS6-4]
68353 [Q6ZUS6-5]
68354 [Q6ZUS6-6]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000389609; ENSP00000374260; ENSG00000181982 [Q6ZUS6-5]
ENST00000502801; ENSP00000427529; ENSG00000181982 [Q6ZUS6-3]
ENST00000504487; ENSP00000425715; ENSG00000181982 [Q6ZUS6-4]
GeneIDi91050
KEGGihsa:91050
UCSCiuc003grc.4 human [Q6ZUS6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		91050
DisGeNETi91050

GeneCards: human genes, protein and diseases

More...GeneCardsi		CCDC149
HGNCiHGNC:25405 CCDC149
HPAiHPA044158
HPA047913
neXtProtiNX_Q6ZUS6
OpenTargetsiENSG00000181982
PharmGKBiPA162381560

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG4687 Eukaryota
ENOG410ZRJ8 LUCA
GeneTreeiENSGT00390000015958
HOGENOMiHOG000015087
InParanoidiQ6ZUS6
OrthoDBi697466at2759
PhylomeDBiQ6ZUS6
TreeFamiTF319794

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		CCDC149 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		91050

Protein Ontology

More...PROi		PR:Q6ZUS6

Gene expression databases

BgeeiENSG00000181982 Expressed in 171 organ(s), highest expression level in parotid gland
ExpressionAtlasiQ6ZUS6 baseline and differential
GenevisibleiQ6ZUS6 HS

Family and domain databases

InterProiView protein in InterPro
IPR019179 Coiled-coil_dom-contain_pr_149
PANTHERiPTHR21682 PTHR21682, 1 hit
PfamiView protein in Pfam
PF09789 DUF2353, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCC149_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6ZUS6
Secondary accession number(s): A6NJE7
, B4DK90, B4DZG3, G5EA04, Q6NW41, Q8N3K8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 22, 2008
Last sequence update: July 22, 2008
Last modified: July 31, 2019
This is version 98 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again