Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Centrosomal protein of 128 kDa

Gene

CEP128

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

  • protein localization Source: GO_Central

Protein family/group databases

MoonDB Database of extreme multifunctional and moonlighting proteins

More...
MoonDBi
Q6ZU80 Predicted

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Centrosomal protein of 128 kDa
Short name:
Cep128
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CEP128
Synonyms:C14orf145, C14orf61
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000100629.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:20359 CEP128

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6ZU80

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
145508

Open Targets

More...
OpenTargetsi
ENSG00000100629

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142672283

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
CEP128

Domain mapping of disease mutations (DMDM)

More...
DMDMi
166214932

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000899461 – 1094Centrosomal protein of 128 kDaAdd BLAST1094

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei31PhosphoserineCombined sources1
Modified residuei249PhosphoserineBy similarity1
Modified residuei291PhosphoserineCombined sources1
Modified residuei331PhosphoserineCombined sources1
Modified residuei1061PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q6ZU80

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6ZU80

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6ZU80

PeptideAtlas

More...
PeptideAtlasi
Q6ZU80

PRoteomics IDEntifications database

More...
PRIDEi
Q6ZU80

ProteomicsDB human proteome resource

More...
ProteomicsDBi
68321
68322 [Q6ZU80-1]
68323 [Q6ZU80-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6ZU80

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6ZU80

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000100629 Expressed in 136 organ(s), highest expression level in left lobe of thyroid gland

CleanEx database of gene expression profiles

More...
CleanExi
HS_C14orf145

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6ZU80 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6ZU80 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA000602
HPA001116
HPA018498

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
126920, 280 interactors

Protein interaction database and analysis system

More...
IntActi
Q6ZU80, 273 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000281129

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q6ZU80

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6ZU80

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili190 – 827Sequence analysisAdd BLAST638
Coiled coili879 – 959Sequence analysisAdd BLAST81

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IGDD Eukaryota
ENOG410XT5I LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000007020

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG106663

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6ZU80

KEGG Orthology (KO)

More...
KOi
K16460

Identification of Orthologs from Complete Genome Data

More...
OMAi
TCEAERK

Database of Orthologous Groups

More...
OrthoDBi
160423at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6ZU80

TreeFam database of animal gene trees

More...
TreeFami
TF331714

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 8 potential isoforms that are computationally mapped.Show allAlign All

Isoform 2 (identifier: Q6ZU80-2) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAESSSESDH FRCRDRLSPW AARSTHRGTR SLPTVEVTEK VNTITSTLQD
60 70 80 90 100
TSRNLRQVDQ MLGRYREYSN GQAGAIEHLK ESLEQSIDQL RSQRLLRNSG
110 120 130 140 150
GRSISVTSLS ASDLDGGTGS ELHHFPPTSP LKDYGDPQGI KRMRSRTGVR
160 170 180 190 200
FVQETDDMTQ LHGFHQSLRD LSSEQIRLGD DFNRELSRRS RSDAETKRAL
210 220 230 240 250
EELTEKLNEA QKQEVVSDRV ERRLQELERE MRTERELVER RQDQLGLMSL
260 270 280 290 300
QLQEALKKQE AKADEHEGAI KNKLRQTETE KNQLEQELEL SRRLLNQSEG
310 320 330 340 350
SRETLLHQVE ELRTQLTKAE GDRKGLQHQV SQISKQQSNY QDEQGEDWRF
360 370 380 390 400
RRGVEREKQD LEKQMSDLRV QLNFSAMASE LEEVKRCMER KDKEKAHLAS
410 420 430 440 450
QVENLTRELE NGEKQQLQML DRLKEIQNHF DTCEAERKHA DLQISELTRH
460 470 480 490 500
AEDATKQAER YLSELQQSEA LKEEAEKRRE DLKLKAQESI RQWKLKHKKL
510 520 530 540 550
ERALEKQSET VDELTGKNNQ ILKEKDELKT QLYAALQQIE NLRKELNDVL
560 570 580 590 600
TKRALQEEEL HSKEEKLRDI KSHQADLELE VKNSLDTIHR LESELKKQSK
610 620 630 640 650
IQSQMKVEKA HLEEEIAELK KSQAQDKAKL LEMQESIKDL SAIRADLANK
660 670 680 690 700
LAEEERAKKA VLKDLSDLTA QAKSRDEETA TIITQLKLER DVHQRELKDL
710 720 730 740 750
TSSLQSVKTK HEQNIQELMK HFKKEKSEAE NHIRTLKAES LEEKNMAKIH
760 770 780 790 800
RGQLEKLKSQ CDRLTEELTQ NENENKKLKL KYQCLKDQLE EREKHISIEE
810 820 830 840 850
EHLRRMEEAR LQLKDQLLCL ETEQESILGV IGKEIDAACK TFSKDSVEKL
860 870 880 890 900
KVFSSGPDIH YDPHRWLAES KTKLQWLCEE LKERENREKN LRHQLMLCRQ
910 920 930 940 950
QLRNLTENKE SELQCLFQQI ERQEQLLDEI HREKRDLLEE TQRKDEEMGS
960 970 980 990 1000
LQDRVIALET STQVALDHLE SVPEKLSLLE DFKDFRDSCS SSERTDGRYS
1010 1020 1030 1040 1050
KYRVRRNSLQ HHQDDTKYRT KSFKGDRTFL EGSHTRGLDH SSSWQDHSRF
1060 1070 1080 1090
LSSPRFSYVN SFTKRTVAPD SASNKEDATM NGTSSQPKKE EYGS
Length:1,094
Mass (Da):128,015
Last modified:January 15, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iBDE05923E3F6B0FF
GO
Isoform 1 (identifier: Q6ZU80-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     987-987: D → R
     988-1094: Missing.

Note: No experimental confirmation available. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:987
Mass (Da):115,784
Checksum:i94F4A1CDF521E942
GO
Isoform 3 (identifier: Q6ZU80-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     404-435: NLTRELENGEKQQLQMLDRLKEIQNHFDTCEA → HINRKCLLNLVQDLDCKDNEILTYSLQSPLHV
     436-1094: Missing.

Note: No experimental confirmation available.
Show »
Length:435
Mass (Da):50,469
Checksum:i62BE596D8FED35E0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 8 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q86TS1Q86TS1_HUMAN
Centrosomal protein of 128 kDa
CEP128
179Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YJE3H0YJE3_HUMAN
Centrosomal protein of 128 kDa
CEP128
679Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YIZ9H0YIZ9_HUMAN
Centrosomal protein of 128 kDa
CEP128
302Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V3F4G3V3F4_HUMAN
Centrosomal protein of 128 kDa
CEP128
127Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YJD7H0YJD7_HUMAN
Centrosomal protein of 128 kDa
CEP128
139Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YJH2H0YJH2_HUMAN
Centrosomal protein of 128 kDa
CEP128
160Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V3U2G3V3U2_HUMAN
Centrosomal protein of 128 kDa
CEP128
32Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
G3V4J9G3V4J9_HUMAN
Centrosomal protein of 128 kDa
CEP128
20Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB71273 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti395K → R in AAH45834 (PubMed:15489334).Curated1
Sequence conflicti973P → A in BAB71273 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03783516R → L. Corresponds to variant dbSNP:rs7160694Ensembl.1
Natural variantiVAR_037836732H → R. Corresponds to variant dbSNP:rs327463Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_030194404 – 435NLTRE…DTCEA → HINRKCLLNLVQDLDCKDNE ILTYSLQSPLHV in isoform 3. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_030195436 – 1094Missing in isoform 3. 1 PublicationAdd BLAST659
Alternative sequenceiVSP_014752987D → R in isoform 1. 1 Publication1
Alternative sequenceiVSP_030196988 – 1094Missing in isoform 1. 1 PublicationAdd BLAST107

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AC010072 Genomic DNA No translation available.
AC022404 Genomic DNA No translation available.
AC018513 Genomic DNA No translation available.
BC045834 mRNA Translation: AAH45834.2
BC150610 mRNA Translation: AAI50611.1
AK056756 mRNA Translation: BAB71273.1 Different initiation.
AK125925 mRNA No translation available.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS32130.1 [Q6ZU80-2]

NCBI Reference Sequences

More...
RefSeqi
NP_689659.2, NM_152446.3 [Q6ZU80-2]
XP_006720119.1, XM_006720056.3

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.162889

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000216517; ENSP00000216517; ENSG00000100629 [Q6ZU80-3]
ENST00000281129; ENSP00000281129; ENSG00000100629 [Q6ZU80-2]
ENST00000555265; ENSP00000451162; ENSG00000100629 [Q6ZU80-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
145508

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:145508

UCSC genome browser

More...
UCSCi
uc001xux.3 human [Q6ZU80-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AC010072 Genomic DNA No translation available.
AC022404 Genomic DNA No translation available.
AC018513 Genomic DNA No translation available.
BC045834 mRNA Translation: AAH45834.2
BC150610 mRNA Translation: AAI50611.1
AK056756 mRNA Translation: BAB71273.1 Different initiation.
AK125925 mRNA No translation available.
CCDSiCCDS32130.1 [Q6ZU80-2]
RefSeqiNP_689659.2, NM_152446.3 [Q6ZU80-2]
XP_006720119.1, XM_006720056.3
UniGeneiHs.162889

3D structure databases

ProteinModelPortaliQ6ZU80
SMRiQ6ZU80
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126920, 280 interactors
IntActiQ6ZU80, 273 interactors
STRINGi9606.ENSP00000281129

Protein family/group databases

MoonDBiQ6ZU80 Predicted

PTM databases

iPTMnetiQ6ZU80
PhosphoSitePlusiQ6ZU80

Polymorphism and mutation databases

BioMutaiCEP128
DMDMi166214932

Proteomic databases

EPDiQ6ZU80
jPOSTiQ6ZU80
PaxDbiQ6ZU80
PeptideAtlasiQ6ZU80
PRIDEiQ6ZU80
ProteomicsDBi68321
68322 [Q6ZU80-1]
68323 [Q6ZU80-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000216517; ENSP00000216517; ENSG00000100629 [Q6ZU80-3]
ENST00000281129; ENSP00000281129; ENSG00000100629 [Q6ZU80-2]
ENST00000555265; ENSP00000451162; ENSG00000100629 [Q6ZU80-2]
GeneIDi145508
KEGGihsa:145508
UCSCiuc001xux.3 human [Q6ZU80-2]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
145508
DisGeNETi145508
EuPathDBiHostDB:ENSG00000100629.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
CEP128

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0011861
HGNCiHGNC:20359 CEP128
HPAiHPA000602
HPA001116
HPA018498
neXtProtiNX_Q6ZU80
OpenTargetsiENSG00000100629
PharmGKBiPA142672283

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410IGDD Eukaryota
ENOG410XT5I LUCA
GeneTreeiENSGT00390000007020
HOVERGENiHBG106663
InParanoidiQ6ZU80
KOiK16460
OMAiTCEAERK
OrthoDBi160423at2759
PhylomeDBiQ6ZU80
TreeFamiTF331714

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
CEP128 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
145508

Protein Ontology

More...
PROi
PR:Q6ZU80

Gene expression databases

BgeeiENSG00000100629 Expressed in 136 organ(s), highest expression level in left lobe of thyroid gland
CleanExiHS_C14orf145
ExpressionAtlasiQ6ZU80 baseline and differential
GenevisibleiQ6ZU80 HS

Family and domain databases

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCE128_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6ZU80
Secondary accession number(s): B9EK52, Q86X97, Q96ML4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 19, 2005
Last sequence update: January 15, 2008
Last modified: January 16, 2019
This is version 114 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again