Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 136 (07 Apr 2021)
Sequence version 1 (05 Jul 2004)
Previous versions | rss
Add a publicationFeedback
Protein

Ras association domain-containing protein 6

Gene

RASSF6

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:4 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Involved in the induction of apoptosis, through both caspase-dependent and caspase-independent pathways. May act as a Ras effector protein. May suppress the serum-induced basal levels of NF-kappa-B (By similarity).By similarity1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processApoptosis

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q6ZTQ3

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q6ZTQ3

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Ras association domain-containing protein 6
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RASSF6
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:20796, RASSF6

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
612620, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6ZTQ3

Eukaryotic Pathogen, Vector and Host Database Resources

More...
VEuPathDBi
HostDB:ENSG00000169435.13

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
166824

Open Targets

More...
OpenTargetsi
ENSG00000169435

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134900075

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q6ZTQ3, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
RASSF6

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74749658

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002404041 – 369Ras association domain-containing protein 6Add BLAST369

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei187PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q6ZTQ3

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q6ZTQ3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6ZTQ3

PeptideAtlas

More...
PeptideAtlasi
Q6ZTQ3

PRoteomics IDEntifications database

More...
PRIDEi
Q6ZTQ3

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
68282 [Q6ZTQ3-1]
68283 [Q6ZTQ3-2]
68284 [Q6ZTQ3-3]
68285 [Q6ZTQ3-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6ZTQ3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6ZTQ3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highest expression in thymus, kidney and placenta. Also detected in colon, small intestine and lung. Tends to be down-regulated in 30-60% of tumors derived from breast, colon, kidney liver, rectum, pancreas, stomach and the thyroid gland compared to the normal counterpart.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000169435, Expressed in palpebral conjunctiva and 137 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6ZTQ3, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000169435, Tissue enhanced (lymphoid)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with MOAP1 (By similarity). Interaction with activated KRAS is still a matter of debate: interaction has been shown in the mouse (PubMed:17404571), but not in human (PubMed:17367779). Lack of interaction with MRAS, NRAS nor RRAS2 has also been reported (PubMed:17367779).

By similarity2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
127936, 10 interactors

Protein interaction database and analysis system

More...
IntActi
Q6ZTQ3, 5 interactors

Molecular INTeraction database

More...
MINTi
Q6ZTQ3

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000340578

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q6ZTQ3, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini218 – 306Ras-associatingPROSITE-ProRule annotationAdd BLAST89
Domaini313 – 360SARAHPROSITE-ProRule annotationAdd BLAST48

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4239, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159886

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_018893_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6ZTQ3

Identification of Orthologs from Complete Genome Data

More...
OMAi
IQDDKQM

Database of Orthologous Groups

More...
OrthoDBi
1043350at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6ZTQ3

TreeFam database of animal gene trees

More...
TreeFami
TF319243

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR033614, C-RASSF
IPR000159, RA_dom
IPR033625, RASSF6
IPR011524, SARAH_dom
IPR029071, Ubiquitin-like_domsf

The PANTHER Classification System

More...
PANTHERi
PTHR22738, PTHR22738, 1 hit
PTHR22738:SF3, PTHR22738:SF3, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF16517, Nore1-SARAH, 1 hit
PF00788, RA, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00314, RA, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54236, SSF54236, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50200, RA, 1 hit
PS50951, SARAH, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q6ZTQ3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLWEETGAAP APARASDLPY RISSDHLKKE EKMTMMAHQY PSWIFINEKT
60 70 80 90 100
FITREQLNSL LKTYNIFYEN QKNLHILYGE TEDGKLIVEG MLDIFWGVKR
110 120 130 140 150
PIQLKIQDEK PFSSFTSMKS SDVFSSKGMT RWGEFDDLYR ISELDRTQIP
160 170 180 190 200
MSEKRNSQED YLSYHSNTLK PHAKDEPDSP VLYRTMSEAA LVRKRMKPLM
210 220 230 240 250
MDRKERQKNR ASINGHFYNH ETSIFIPAFE SETKVRVNSN MRTEEVIKQL
260 270 280 290 300
LQKFKIENSP QDFALHIIFA TGEQRRLKKT DIPLLQRLLQ GPSEKNARIF
310 320 330 340 350
LMDKDAEEIS SDVAQYINFH FSLLESILQR LNEEEKREIQ RIVTKFNKEK
360
AIILKCLQNK LVIKTETTV
Length:369
Mass (Da):43,384
Last modified:July 5, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i19AF7D4B1ABA5ED6
GO
Isoform 2 (identifier: Q6ZTQ3-2) [UniParc]FASTAAdd to basket
Also known as: A

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: Missing.

Show »
Length:337
Mass (Da):39,804
Checksum:i68D026FC687DFDD8
GO
Isoform 3 (identifier: Q6ZTQ3-3) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     23-80: SSDHLKKEEKMTMMAHQYPSWIFINEKTFITREQLNSLLKTYNIFYENQKNLHILYGE → HFLSSGLILVTRQL

Show »
Length:325
Mass (Da):37,872
Checksum:i91C71FBC2E18D6D9
GO
Isoform 4 (identifier: Q6ZTQ3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: Missing.
     222-255: Missing.

Show »
Length:303
Mass (Da):35,809
Checksum:i7B4510499A52918E
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH58835 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence CAH18138 differs from that shown. Reason: Erroneous termination. Truncated C-terminus.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_026725163S → P1 PublicationCorresponds to variant dbSNP:rs12507775Ensembl.1
Natural variantiVAR_034440306A → G. Corresponds to variant dbSNP:rs17804499Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0193701 – 32Missing in isoform 2 and isoform 4. 3 PublicationsAdd BLAST32
Alternative sequenceiVSP_01937123 – 80SSDHL…ILYGE → HFLSSGLILVTRQL in isoform 3. 1 PublicationAdd BLAST58
Alternative sequenceiVSP_019372222 – 255Missing in isoform 4. 1 PublicationAdd BLAST34

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY217665 mRNA Translation: AAO61690.1
AY217664 mRNA Translation: AAO61689.1
AK126346 mRNA Translation: BAC86530.1
CR749283 mRNA Translation: CAH18138.1 Sequence problems.
BC058835 mRNA Translation: AAH58835.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS3558.1 [Q6ZTQ3-1]
CCDS3559.1 [Q6ZTQ3-2]
CCDS58904.1 [Q6ZTQ3-4]
CCDS58905.1 [Q6ZTQ3-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001257320.1, NM_001270391.1 [Q6ZTQ3-4]
NP_001257321.1, NM_001270392.1 [Q6ZTQ3-3]
NP_803876.1, NM_177532.4 [Q6ZTQ3-2]
NP_958834.1, NM_201431.2 [Q6ZTQ3-1]
XP_011529990.1, XM_011531688.1 [Q6ZTQ3-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000307439; ENSP00000303877; ENSG00000169435 [Q6ZTQ3-2]
ENST00000335049; ENSP00000335582; ENSG00000169435 [Q6ZTQ3-3]
ENST00000342081; ENSP00000340578; ENSG00000169435 [Q6ZTQ3-1]
ENST00000395777; ENSP00000379123; ENSG00000169435 [Q6ZTQ3-4]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
166824

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:166824

UCSC genome browser

More...
UCSCi
uc003hhc.3, human [Q6ZTQ3-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross%5Freferences%5Fsection">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY217665 mRNA Translation: AAO61690.1
AY217664 mRNA Translation: AAO61689.1
AK126346 mRNA Translation: BAC86530.1
CR749283 mRNA Translation: CAH18138.1 Sequence problems.
BC058835 mRNA Translation: AAH58835.1 Different initiation.
CCDSiCCDS3558.1 [Q6ZTQ3-1]
CCDS3559.1 [Q6ZTQ3-2]
CCDS58904.1 [Q6ZTQ3-4]
CCDS58905.1 [Q6ZTQ3-3]
RefSeqiNP_001257320.1, NM_001270391.1 [Q6ZTQ3-4]
NP_001257321.1, NM_001270392.1 [Q6ZTQ3-3]
NP_803876.1, NM_177532.4 [Q6ZTQ3-2]
NP_958834.1, NM_201431.2 [Q6ZTQ3-1]
XP_011529990.1, XM_011531688.1 [Q6ZTQ3-2]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi127936, 10 interactors
IntActiQ6ZTQ3, 5 interactors
MINTiQ6ZTQ3
STRINGi9606.ENSP00000340578

PTM databases

iPTMnetiQ6ZTQ3
PhosphoSitePlusiQ6ZTQ3

Genetic variation databases

BioMutaiRASSF6
DMDMi74749658

Proteomic databases

EPDiQ6ZTQ3
MassIVEiQ6ZTQ3
PaxDbiQ6ZTQ3
PeptideAtlasiQ6ZTQ3
PRIDEiQ6ZTQ3
ProteomicsDBi68282 [Q6ZTQ3-1]
68283 [Q6ZTQ3-2]
68284 [Q6ZTQ3-3]
68285 [Q6ZTQ3-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
24560, 198 antibodies

The DNASU plasmid repository

More...
DNASUi
166824

Genome annotation databases

EnsembliENST00000307439; ENSP00000303877; ENSG00000169435 [Q6ZTQ3-2]
ENST00000335049; ENSP00000335582; ENSG00000169435 [Q6ZTQ3-3]
ENST00000342081; ENSP00000340578; ENSG00000169435 [Q6ZTQ3-1]
ENST00000395777; ENSP00000379123; ENSG00000169435 [Q6ZTQ3-4]
GeneIDi166824
KEGGihsa:166824
UCSCiuc003hhc.3, human [Q6ZTQ3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
166824
DisGeNETi166824

GeneCards: human genes, protein and diseases

More...
GeneCardsi
RASSF6
HGNCiHGNC:20796, RASSF6
HPAiENSG00000169435, Tissue enhanced (lymphoid)
MIMi612620, gene
neXtProtiNX_Q6ZTQ3
OpenTargetsiENSG00000169435
PharmGKBiPA134900075
VEuPathDBiHostDB:ENSG00000169435.13

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4239, Eukaryota
GeneTreeiENSGT00940000159886
HOGENOMiCLU_018893_0_0_1
InParanoidiQ6ZTQ3
OMAiIQDDKQM
OrthoDBi1043350at2759
PhylomeDBiQ6ZTQ3
TreeFamiTF319243

Enzyme and pathway databases

PathwayCommonsiQ6ZTQ3
SIGNORiQ6ZTQ3

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
166824, 4 hits in 984 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
RASSF6, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
166824
PharosiQ6ZTQ3, Tbio

Protein Ontology

More...
PROi
PR:Q6ZTQ3
RNActiQ6ZTQ3, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000169435, Expressed in palpebral conjunctiva and 137 other tissues
GenevisibleiQ6ZTQ3, HS

Family and domain databases

InterProiView protein in InterPro
IPR033614, C-RASSF
IPR000159, RA_dom
IPR033625, RASSF6
IPR011524, SARAH_dom
IPR029071, Ubiquitin-like_domsf
PANTHERiPTHR22738, PTHR22738, 1 hit
PTHR22738:SF3, PTHR22738:SF3, 1 hit
PfamiView protein in Pfam
PF16517, Nore1-SARAH, 1 hit
PF00788, RA, 1 hit
SMARTiView protein in SMART
SM00314, RA, 1 hit
SUPFAMiSSF54236, SSF54236, 1 hit
PROSITEiView protein in PROSITE
PS50200, RA, 1 hit
PS50951, SARAH, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRASF6_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6ZTQ3
Secondary accession number(s): Q68DT2
, Q6PDA6, Q86WG9, Q86WH0
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: June 27, 2006
Last sequence update: July 5, 2004
Last modified: April 7, 2021
This is version 136 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again