Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 148 (17 Jun 2020)
Sequence version 2 (15 Jan 2008)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

E3 ubiquitin-protein ligase UBR3

Gene

UBR3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

E3 ubiquitin-protein ligase which is a component of the N-end rule pathway (By similarity). Does not bind to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation (By similarity). May play a role in Shh signaling by mediating the ubiquitination of Kif7 (By similarity). May be important for MYH9 function in certain tissues, possibly by regulating the ubiquitination of MYH9 and consequently affecting its interaction with MYO7A (PubMed:27331610).By similarity1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. EC:2.3.2.27

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri118 – 189UBR-typePROSITE-ProRule annotationAdd BLAST72
Zinc fingeri1306 – 1364RING-type; degenerateAdd BLAST59

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTransferase
Biological processUbl conjugation pathway
LigandMetal-binding, Zinc

Enzyme and pathway databases

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00143

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
E3 ubiquitin-protein ligase UBR3 (EC:2.3.2.27)
Alternative name(s):
N-recognin-3
RING-type E3 ubiquitin transferase UBR3
Ubiquitin-protein ligase E3-alpha-3
Ubiquitin-protein ligase E3-alpha-III
Zinc finger protein 650
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:UBR3
Synonyms:KIAA2024, ZNF650
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 2

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000144357.16

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30467 UBR3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
613831 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6ZT12

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei761 – 781HelicalSequence analysisAdd BLAST21
Transmembranei919 – 939HelicalSequence analysisAdd BLAST21
Transmembranei1806 – 1826HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
130507

Open Targets

More...
OpenTargetsi
ENSG00000144357

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162407919

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q6ZT12 Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
UBR3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
166214992

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002781841 – 1888E3 ubiquitin-protein ligase UBR3Add BLAST1888

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei343PhosphoserineBy similarity1
Modified residuei344PhosphoserineBy similarity1
Modified residuei1199PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q6ZT12

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6ZT12

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q6ZT12

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q6ZT12

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6ZT12

PeptideAtlas

More...
PeptideAtlasi
Q6ZT12

PRoteomics IDEntifications database

More...
PRIDEi
Q6ZT12

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
68252 [Q6ZT12-1]
68253 [Q6ZT12-2]
68254 [Q6ZT12-3]
68255 [Q6ZT12-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6ZT12

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6ZT12

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000144357 Expressed in biceps brachii and 208 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6ZT12 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6ZT12 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000144357 Tissue enhanced (skeletal)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with UBE2A and UBE2B.

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
126237, 53 interactors

Protein interaction database and analysis system

More...
IntActi
Q6ZT12, 31 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000396068

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q6ZT12 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6ZT12

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili1168 – 1199Sequence analysisAdd BLAST32

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi2 – 118Ala-richAdd BLAST117
Compositional biasi1766 – 1808Cys-richAdd BLAST43

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the UBR1 family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri118 – 189UBR-typePROSITE-ProRule annotationAdd BLAST72
Zinc fingeri1306 – 1364RING-type; degenerateAdd BLAST59

Keywords - Domaini

Coiled coil, Transmembrane, Transmembrane helix, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1139 Eukaryota
ENOG410XRM3 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000183075

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_000651_2_1_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6ZT12

KEGG Orthology (KO)

More...
KOi
K11978

Identification of Orthologs from Complete Genome Data

More...
OMAi
TLTDFEC

Database of Orthologous Groups

More...
OrthoDBi
81415at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6ZT12

TreeFam database of animal gene trees

More...
TreeFami
TF323875

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR039164 UBR1-like
IPR003126 Znf_UBR

The PANTHER Classification System

More...
PANTHERi
PTHR21497 PTHR21497, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02207 zf-UBR, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00396 ZnF_UBR1, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51157 ZF_UBR, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6ZT12-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAAAAAAAVG GQQPSQPELP APGLALDKAA TAAHLKAALS RPDNRAGAEE
60 70 80 90 100
LQALLERVLS AERPLAAAAG GEDAAAAGGG GGPGAAEEEA LEWCKCLLAG
110 120 130 140 150
GGGYDEFCAA VRAYDPAALC GLVWTANFVA YRCRTCGISP CMSLCAECFH
160 170 180 190 200
QGDHTGHDFN MFRSQAGGAC DCGDSNVMRE SGFCKRHQIK SSSNIPCVPK
210 220 230 240 250
DLLMMSEFVL PRFIFCLIQY LREGYNEPAA DGPSEKDLNK VLQLLEPQIS
260 270 280 290 300
FLEDLTKMGG AMRSVLTQVL TNQQNYKDLT SGLGENACVK KSHEKYLIAL
310 320 330 340 350
KSSGLTYPED KLVYGVQEPS AGTSSLAVQG FIGATGTLGQ VDSSDEDDQD
360 370 380 390 400
GSQGLGKRKR VKLSSGTKDQ SIMDVLKHKS FLEELLFWTI KYEFPQKMVT
410 420 430 440 450
FLLNMLPDQE YKVAFTKTFV QHYAFIMKTL KKSHESDTMS NRIVHISVQL
460 470 480 490 500
FSNEELARQV TEECQLLDIM VTVLLYMMES CLIKSELQDE ENSLHVVVNC
510 520 530 540 550
GEALLKNNTY WPLVSDFINI LSHQSVAKRF LEDHGLLVTW MNFVSFFQGM
560 570 580 590 600
NLNKRELNEH VEFESQTYYA AFAAELEACA QPMWGLLSHC KVRETQEYTR
610 620 630 640 650
NVVRYCLEAL QDWFDAINFV DEPAPNQVTF HLPLHRYYAM FLSKAVKCQE
660 670 680 690 700
LDLDSVLPDQ EMLMKLMIHP LQIQASLAEI HSNMWVRNGL QIKGQAMTYV
710 720 730 740 750
QSHFCNSMID PDIYLLQVCA SRLDPDYFIS SVFERFKVVD LLTMASQHQN
760 770 780 790 800
TVLDAEHERS MLEGALTFLV ILLSLRLHLG MSDDEILRAE MVAQLCMNDR
810 820 830 840 850
THSSLLDLIP ENPNPKSGII PGSYSFESVL SAVADFKAPV FEPGGSMQQG
860 870 880 890 900
MYTPKAEVWD QEFDPVMVIL RTVYRRDVQS AMDRYTAFLK QSGKFPGNPW
910 920 930 940 950
PPYKKRTSLH PSYKGLMRLL HCKTLHIVLF TLLYKILMDH QNLSEHVLCM
960 970 980 990 1000
VLYLIELGLE NSAEEESDEE ASVGGPERCH DSWFPGSNLV SNMRHFINYV
1010 1020 1030 1040 1050
RVRVPETAPE VKRDSPASTS SDNLGSLQNS GTAQVFSLVA ERRKKFQEII
1060 1070 1080 1090 1100
NRSSSEANQV VRPKTSSKWS APGSAPQLTT AILEIKESIL SLLIKLHHKL
1110 1120 1130 1140 1150
SGKQNSYYPP WLDDIEILIQ PEIPKYSHGD GITAVERILL KAASQSRMNK
1160 1170 1180 1190 1200
RIIEEICRKV TPPVPPKKVT AAEKKTLDKE ERRQKARERQ QKLLAEFASR
1210 1220 1230 1240 1250
QKSFMETAMD VDSPENDIPM EITTAEPQVS EAVYDCVICG QSGPSSEDRP
1260 1270 1280 1290 1300
TGLVVLLQAS SVLGQCRDNV EPKKLPISEE EQIYPWDTCA AVHDVRLSLL
1310 1320 1330 1340 1350
QRYFKDSSCL LAVSIGWEGG VYVQTCGHTL HIDCHKSYME SLRNDQVLQG
1360 1370 1380 1390 1400
FSVDKGEFTC PLCRQFANSV LPCYPGSNVE NNPWQRPSNK SIQDLIKEVE
1410 1420 1430 1440 1450
ELQGRPGAFP SETNLSKEME SVMKDIKNTT QKKYRDYSKT PGSPDNDFLF
1460 1470 1480 1490 1500
MYSVARTNLE LELIHRGGNL CSGGASTAGK RSCLNQLFHV LALHMRLYSI
1510 1520 1530 1540 1550
DSEYNPWRKL TQLEEMNPQL GYEEQQPEVP ILYHDVTSLL LIQILMMPQP
1560 1570 1580 1590 1600
LRKDHFTCIV KVLFTLLYTQ ALAALSVKCS EEDRSAWKHA GALKKSTCDA
1610 1620 1630 1640 1650
EKSYEVLLSF VISELFKGKL YHEEGTQECA MVNPIAWSPE SMEKCLQDFC
1660 1670 1680 1690 1700
LPFLRITSLL QHHLFGEDLP SCQEEEEFSV LASCLGLLPT FYQTEHPFIS
1710 1720 1730 1740 1750
ASCLDWPVPA FDIITQWCFE IKSFTERHAE QGKALLIQES KWKLPHLLQL
1760 1770 1780 1790 1800
PENYNTIFQY YHRKTCSVCT KVPKDPAVCL VCGTFVCLKG LCCKQQSYCE
1810 1820 1830 1840 1850
CVLHSQNCGA GTGIFLLINA SVIIIIRGHR FCLWGSVYLD AHGEEDRDLR
1860 1870 1880
RGKPLYICKE RYKVLEQQWI SHTFDHINKR WGPHYNGL
Length:1,888
Mass (Da):212,433
Last modified:January 15, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5F5525B33D2E9153
GO
Isoform 2 (identifier: Q6ZT12-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1179: Missing.
     1180-1211: EERRQKARERQQKLLAEFASRQKSFMETAMDV → MIASKQRQFTEVFRIMSSTFSQSRFLYAAVVT

Show »
Length:709
Mass (Da):80,668
Checksum:i31BAF308F2AD6FB1
GO
Isoform 3 (identifier: Q6ZT12-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1494: Missing.

Show »
Length:394
Mass (Da):45,533
Checksum:i4B1B5048589F8CA6
GO
Isoform 4 (identifier: Q6ZT12-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1485-1485: N → NFCFIISPFTKSEIILCQYRKSHDKVYPKY

Show »
Length:1,917
Mass (Da):215,971
Checksum:iD4EC272A57F7B564
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0Y3K2H0Y3K2_HUMAN
E3 ubiquitin-protein ligase
UBR3
950Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7C481H7C481_HUMAN
E3 ubiquitin-protein ligase
UBR3
384Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H7BZD8H7BZD8_HUMAN
E3 ubiquitin-protein ligase
UBR3
588Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WEB7F8WEB7_HUMAN
E3 ubiquitin-protein ligase UBR3
UBR3
77Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC23120 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC86783 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC87032 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAG64179 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAD38857 differs from that shown. Reason: Erroneous termination. Truncated C-terminus.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1791L → F in BAC87032 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0231411 – 1494Missing in isoform 3. 1 PublicationAdd BLAST1494
Alternative sequenceiVSP_0303541 – 1179Missing in isoform 2. 1 PublicationAdd BLAST1179
Alternative sequenceiVSP_0231421180 – 1211EERRQ…TAMDV → MIASKQRQFTEVFRIMSSTF SQSRFLYAAVVT in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_0364051485N → NFCFIISPFTKSEIILCQYR KSHDKVYPKY in isoform 4. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB095944 mRNA Translation: BAC23120.1 Different initiation.
AK126998 mRNA Translation: BAC86783.1 Different initiation.
AK127553 mRNA Translation: BAC87032.1 Different initiation.
AK128490 mRNA Translation: BAC87462.1
AK303062 mRNA Translation: BAG64179.1 Different initiation.
AC009967 Genomic DNA No translation available.
AC079151 Genomic DNA No translation available.
AC092641 Genomic DNA Translation: AAY14890.1
AL834144 mRNA Translation: CAD38857.1 Sequence problems.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2238.2 [Q6ZT12-1]

NCBI Reference Sequences

More...
RefSeqi
NP_742067.3, NM_172070.3 [Q6ZT12-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000272793; ENSP00000272793; ENSG00000144357 [Q6ZT12-1]
ENST00000418381; ENSP00000396068; ENSG00000144357 [Q6ZT12-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
130507

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:130507

UCSC genome browser

More...
UCSCi
uc010zdi.3 human [Q6ZT12-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB095944 mRNA Translation: BAC23120.1 Different initiation.
AK126998 mRNA Translation: BAC86783.1 Different initiation.
AK127553 mRNA Translation: BAC87032.1 Different initiation.
AK128490 mRNA Translation: BAC87462.1
AK303062 mRNA Translation: BAG64179.1 Different initiation.
AC009967 Genomic DNA No translation available.
AC079151 Genomic DNA No translation available.
AC092641 Genomic DNA Translation: AAY14890.1
AL834144 mRNA Translation: CAD38857.1 Sequence problems.
CCDSiCCDS2238.2 [Q6ZT12-1]
RefSeqiNP_742067.3, NM_172070.3 [Q6ZT12-1]

3D structure databases

SMRiQ6ZT12
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi126237, 53 interactors
IntActiQ6ZT12, 31 interactors
STRINGi9606.ENSP00000396068

PTM databases

iPTMnetiQ6ZT12
PhosphoSitePlusiQ6ZT12

Polymorphism and mutation databases

BioMutaiUBR3
DMDMi166214992

Proteomic databases

EPDiQ6ZT12
jPOSTiQ6ZT12
MassIVEiQ6ZT12
MaxQBiQ6ZT12
PaxDbiQ6ZT12
PeptideAtlasiQ6ZT12
PRIDEiQ6ZT12
ProteomicsDBi68252 [Q6ZT12-1]
68253 [Q6ZT12-2]
68254 [Q6ZT12-3]
68255 [Q6ZT12-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
33822 37 antibodies

Genome annotation databases

EnsembliENST00000272793; ENSP00000272793; ENSG00000144357 [Q6ZT12-1]
ENST00000418381; ENSP00000396068; ENSG00000144357 [Q6ZT12-1]
GeneIDi130507
KEGGihsa:130507
UCSCiuc010zdi.3 human [Q6ZT12-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
130507
DisGeNETi130507
EuPathDBiHostDB:ENSG00000144357.16

GeneCards: human genes, protein and diseases

More...
GeneCardsi
UBR3
HGNCiHGNC:30467 UBR3
HPAiENSG00000144357 Tissue enhanced (skeletal)
MIMi613831 gene
neXtProtiNX_Q6ZT12
OpenTargetsiENSG00000144357
PharmGKBiPA162407919

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1139 Eukaryota
ENOG410XRM3 LUCA
GeneTreeiENSGT00950000183075
HOGENOMiCLU_000651_2_1_1
InParanoidiQ6ZT12
KOiK11978
OMAiTLTDFEC
OrthoDBi81415at2759
PhylomeDBiQ6ZT12
TreeFamiTF323875

Enzyme and pathway databases

UniPathwayiUPA00143

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
130507 2 hits in 785 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
UBR3 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
130507
PharosiQ6ZT12 Tbio

Protein Ontology

More...
PROi
PR:Q6ZT12
RNActiQ6ZT12 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000144357 Expressed in biceps brachii and 208 other tissues
ExpressionAtlasiQ6ZT12 baseline and differential
GenevisibleiQ6ZT12 HS

Family and domain databases

InterProiView protein in InterPro
IPR039164 UBR1-like
IPR003126 Znf_UBR
PANTHERiPTHR21497 PTHR21497, 1 hit
PfamiView protein in Pfam
PF02207 zf-UBR, 1 hit
SMARTiView protein in SMART
SM00396 ZnF_UBR1, 1 hit
PROSITEiView protein in PROSITE
PS51157 ZF_UBR, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiUBR3_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6ZT12
Secondary accession number(s): B4DZR7
, Q2KHN5, Q6ZR55, Q6ZSC2, Q8IVE7, Q8ND96
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 20, 2007
Last sequence update: January 15, 2008
Last modified: June 17, 2020
This is version 148 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again