Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 126 (13 Feb 2019)
Sequence version 3 (25 Nov 2008)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

WD repeat- and FYVE domain-containing protein 4

Gene

WDFY4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q6ZS81

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
WD repeat- and FYVE domain-containing protein 4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:WDFY4
Synonyms:C10orf64, KIAA1607
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000128815.17

Human Gene Nomenclature Database

More...
HGNCi
HGNC:29323 WDFY4

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
613316 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6ZS81

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei1627 – 1647HelicalSequence analysisAdd BLAST21
Transmembranei2048 – 2068HelicalSequence analysisAdd BLAST21

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
57705

Open Targets

More...
OpenTargetsi
ENSG00000128815

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134967634

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
WDFY4

Domain mapping of disease mutations (DMDM)

More...
DMDMi
215274123

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002512541 – 3184WD repeat- and FYVE domain-containing protein 4Add BLAST3184

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q6ZS81

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6ZS81

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q6ZS81

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6ZS81

PeptideAtlas

More...
PeptideAtlasi
Q6ZS81

PRoteomics IDEntifications database

More...
PRIDEi
Q6ZS81

ProteomicsDB human proteome resource

More...
ProteomicsDBi
68196
68197 [Q6ZS81-2]
68198 [Q6ZS81-3]
68199 [Q6ZS81-4]
68200 [Q6ZS81-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6ZS81

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6ZS81

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000128815 Expressed in 147 organ(s), highest expression level in superficial temporal artery

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6ZS81 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6ZS81 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA040634

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
121729, 1 interactor

Protein interaction database and analysis system

More...
IntActi
Q6ZS81, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000320563

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q6ZS81

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini2385 – 2510BEACH-type PHPROSITE-ProRule annotationAdd BLAST126
Domaini2527 – 2821BEACHPROSITE-ProRule annotationAdd BLAST295
<p>This subsection of the ‘Family and Domains’ section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati2863 – 2922WD 1Add BLAST60
Repeati2923 – 2972WD 2Add BLAST50
Repeati2973 – 3014WD 3Add BLAST42
Repeati3015 – 3057WD 4Add BLAST43
Repeati3058 – 3141WD 5Add BLAST84
Repeati3142 – 3184WD 6Add BLAST43

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix, WD repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1786 Eukaryota
KOG1788 Eukaryota
ENOG410XNQC LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000155684

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6ZS81

Identification of Orthologs from Complete Genome Data

More...
OMAi
VVRHMSR

Database of Orthologous Groups

More...
OrthoDBi
101142at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6ZS81

TreeFam database of animal gene trees

More...
TreeFami
TF313658

Family and domain databases

Conserved Domains Database

More...
CDDi
cd06071 Beach, 1 hit
cd01201 PH_BEACH, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.1540.10, 1 hit
2.130.10.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR016024 ARM-type_fold
IPR000409 BEACH_dom
IPR036372 BEACH_dom_sf
IPR023362 PH-BEACH_dom
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02138 Beach, 1 hit
PF00400 WD40, 2 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM01026 Beach, 1 hit
SM00320 WD40, 5 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48371 SSF48371, 2 hits
SSF50978 SSF50978, 1 hit
SSF81837 SSF81837, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50197 BEACH, 1 hit
PS51783 PH_BEACH, 1 hit
PS00678 WD_REPEATS_1, 1 hit
PS50082 WD_REPEATS_2, 2 hits
PS50294 WD_REPEATS_REGION, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6ZS81-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEAEDLSKAE DRNEDPGSKN EGQLAAVQPD VPHGGQSSSP TALWDMLERK
60 70 80 90 100
FLEYQQLTHK SPIERQKSLL SLLPLFLKAW EHSVGIICFP SLQRLAEDVS
110 120 130 140 150
DQLAQQLQKA LVGKPAEQAR LAAGQLLWWK GDVDQDGYLL LKSVYVLTGT
160 170 180 190 200
DSETLGRVAE SGLPALLLQC LYLFFVFPLD KDELLESDLQ VQKMFVQMLL
210 220 230 240 250
NICSDSQGLE GLLSGSELQS LLIATTCLRE HSCCFWKEPT FCVLRAISKA
260 270 280 290 300
QNLSIIQYLQ ATDCVRLSLQ NLSRLTDTLP APEVSEAVSL ILGFVKDSYP
310 320 330 340 350
VSSALFLEFE NSEGYPLLLK VLLRYDGLTQ SEVDPHLEEL LGLVVWLTTC
360 370 380 390 400
GRSELKVFDS ITYPQLEGFK FHHEASGVTV KNLQAFQVLQ NVFHKASDSV
410 420 430 440 450
LCIQVLSVIR TMWAWNARNF FLLEWTLQPI SQFVEIMPLK PAPVQEHFFQ
460 470 480 490 500
LLEALVFELH YVPHEILRKV QHLIKESPGP SCTLMALQSI LSIAGGDPLF
510 520 530 540 550
TDIFRDSGLL GLLLAQLRKQ AKIMRKSGNK VSTPGVQDPE RELTCVMLRI
560 570 580 590 600
VVTLLKGSVR NAVVLKDHGM VPFIKIFLDD ECYREASLSI LEQLSAINAE
610 620 630 640 650
EYMSIIVGAL CSSTQGELQL KLDLLKSLLR ILVTPKGRAA FRVSSGFNGL
660 670 680 690 700
LSLLSDLEGS LQEPPLQAWG AVSPRQTLEL VLYTLCAVSA ALHWDPVNGY
710 720 730 740 750
FFRRNGLFEK LAEDLCLLGC FGALEEEGNL LRSWVDTKAR PFADLLGTAF
760 770 780 790 800
SSSGSLPPRI QSCLQILGFL DSMASGTLHL RGDLKESLRT KQGPVVDVQK
810 820 830 840 850
GETGSDPQRN FKQWPDLEER MDEGDAAIMH PGVVCIMVRL LPRLYHEDHP
860 870 880 890 900
QLSEEIQCSL ASHIQSLVKS EKNRQVMCEA GLLGTLMASC HRALVTSGSP
910 920 930 940 950
LHSRLIRIFE KLASQAIEPD VLRQFLGLGI PSSLSATTKI LDSSHTHRGN
960 970 980 990 1000
PGCSGSQTAQ GLAEGPWPAA PDAGLHPGVT QAPQPLGESQ DSTTALQTAL
1010 1020 1030 1040 1050
SLISMTSPRN LQPQRAALAP SFVEFDMSVE GYGCLFIPTL STVMGTSTEY
1060 1070 1080 1090 1100
SVSGGIGTGA TRPFPPPGGL TFSCWFLISR HGAATEGHPL RFLTLVRHLA
1110 1120 1130 1140 1150
RTEQPFVCFS VSLCPDDLSL VVSTEEKEFQ PLDVMEPEDD SEPSAGCQLQ
1160 1170 1180 1190 1200
VRCGQLLACG QWHHLAVVVT KEMKRHCTVS TCLDGQVIGS AKMLYIQALP
1210 1220 1230 1240 1250
GPFLSMDPSA FVDVYGYIAT PRVWKQKSSL IWRLGPTYLF EEAISMETLE
1260 1270 1280 1290 1300
VINKLGPRYC GNFQAVHVQG EDLDSEATPF VAEERVSFGL HIASSSITSV
1310 1320 1330 1340 1350
ADIRNAYNEV DSRLIAKEMN ISSRDNAMPV FLLRNCAGHL SGSLRTIGAV
1360 1370 1380 1390 1400
AVGQLGVRVF HSSPAASSLD FIGGPAILLG LISLATDDHT MYAAVKVLHS
1410 1420 1430 1440 1450
VLTSNAMCDF LMQHICGYQI MAFLLRKKAS LLNHRIFQLI LSVAGTVELG
1460 1470 1480 1490 1500
FRSSAITNTG VFQHILCNFE LWMNTADNLE LSLFSHLLEI LQSPREGPRN
1510 1520 1530 1540 1550
AEAAHQAQLI PKLIFLFNEP SLIPSKISTI IGILACQLRG HFSTQDLLRI
1560 1570 1580 1590 1600
GLFVVYTLKP SSVNERQICM DGALDPSLPA GSQTSGKTIW LRNQLLEMLL
1610 1620 1630 1640 1650
SVISSPQLHL SSESKEEMFL KLGPDWFLLL LQGHLHASTT VLALKLLLYF
1660 1670 1680 1690 1700
LASPSLRTRF RDGLCAGSWV ERSTEGVDIV MDNLKSQSPL PEQSPCLLPG
1710 1720 1730 1740 1750
FRVLNDFLAH HVHIPEVYLI VSTFFLQTPL TELMDGPKDS LDAMLQWLLQ
1760 1770 1780 1790 1800
RHHQEEVLQA GLCTEGALLL LEMLKATMSQ PLAGSEDGAW AQTFPASVLQ
1810 1820 1830 1840 1850
FLSLVHRTYP QDPAWRAPEF LQTLAIAAFP LGAQKGVGAE STRNTSSPEA
1860 1870 1880 1890 1900
AAEGDSTVEG LQAPTKAHPA RRKLREFTQL LLRELLLGAS SPKQWLPLEV
1910 1920 1930 1940 1950
LLEASPDHAT SQQKRDFQSE VLLSAMELFH MTSGGDAAMF RDGKEPQPSA
1960 1970 1980 1990 2000
EAAAAPSLAN ISCFTQKLVE KLYSGMFSAD PRHILLFILE HIMVVIETAS
2010 2020 2030 2040 2050
SQRDTVLSTL YSSLNKVILY CLSKPQQSLS ECLGLLSILG FLQEHWDVVF
2060 2070 2080 2090 2100
ATYNSNISFL LCLMHCLLLL NERSYPEGFG LEPKPRMSTY HQVFLSPNED
2110 2120 2130 2140 2150
VKEKREDLPS LSDVQHNIQK TVQTLWQQLV AQRQQTLEDA FKIDLSVKPG
2160 2170 2180 2190 2200
EREVKIEEVT PLWEETMLKA WQHYLASEKK SLASRSNVAH HSKVTLWSGS
2210 2220 2230 2240 2250
LSSAMKLMPG RQAKDPECKT EDFVSCIENY RRRGQELYAS LYKDHVQRRK
2260 2270 2280 2290 2300
CGNIKAANAW ARIQEQLFGE LGLWSQGEET KPCSPWELDW REGPARMRKR
2310 2320 2330 2340 2350
IKRLSPLEAL SSGRHKESQD KNDHISQTNA ENQDELTLRE AEGEPDEVGV
2360 2370 2380 2390 2400
DCTQLTFFPA LHESLHSEDF LELCRERQVI LQELLDKEKV TQKFSLVIVQ
2410 2420 2430 2440 2450
GHLVSEGVLL FGHQHFYICE NFTLSPTGDV YCTRHCLSNI SDPFIFNLCS
2460 2470 2480 2490 2500
KDRSTDHYSC QCHSYADMRE LRQARFLLQD IALEIFFHNG YSKFLVFYNN
2510 2520 2530 2540 2550
DRSKAFKSFC SFQPSLKGKA TSEDTLSLRR YPGSDRIMLQ KWQKRDISNF
2560 2570 2580 2590 2600
EYLMYLNTAA GRTCNDYMQY PVFPWVLADY TSETLNLANP KIFRDLSKPM
2610 2620 2630 2640 2650
GAQTKERKLK FIQRFKEVEK TEGDMTVQCH YYTHYSSAII VASYLVRMPP
2660 2670 2680 2690 2700
FTQAFCALQG GSFDVADRMF HSVKSTWESA SRENMSDVRE LTPEFFYLPE
2710 2720 2730 2740 2750
FLTNCNGVEF GCMQDGTVLG DVQLPPWADG DPRKFISLHR KALESDFVSA
2760 2770 2780 2790 2800
NLHHWIDLIF GYKQQGPAAV DAVNIFHPYF YGDRMDLSSI TDPLIKSTIL
2810 2820 2830 2840 2850
GFVSNFGQVP KQLFTKPHPA RTAAGKPLPG KDVSTPVSLP GHPQPFFYSL
2860 2870 2880 2890 2900
QSLRPSQVTV KDMYLFSLGS ESPKGAIGHI VSTEKTILAV ERNKVLLPPL
2910 2920 2930 2940 2950
WNRTFSWGFD DFSCCLGSYG SDKVLMTFEN LAAWGRCLCA VCPSPTTIVT
2960 2970 2980 2990 3000
SGTSTVVCVW ELSMTKGRPR GLRLRQALYG HTQAVTCLAA SVTFSLLVSG
3010 3020 3030 3040 3050
SQDCTCILWD LDHLTHVTRL PAHREGISAI TISDVSGTIV SCAGAHLSLW
3060 3070 3080 3090 3100
NVNGQPLASI TTAWGPEGAI TCCCLMEGPA WDTSQIIITG SQDGMVRVWK
3110 3120 3130 3140 3150
TEDVKMSVPG RPAGEEPPAQ PPSPRGHKWE KNLALSRELD VSIALTGKPS
3160 3170 3180
KTSPAVTALA VSRNHTKLLV GDERGRIFCW SADG
Length:3,184
Mass (Da):353,610
Last modified:November 25, 2008 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6743F924EE534E44
GO
Isoform 2 (identifier: Q6ZS81-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     627-654: SLLRILVTPKGRAAFRVSSGFNGLLSLL → VISSPPLRLASLWICTKRSTFAQAFVFM
     655-3184: Missing.

Note: No experimental confirmation available.
Show »
Length:654
Mass (Da):73,196
Checksum:iEC85C73B9A9BBE16
GO
Isoform 3 (identifier: Q6ZS81-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1007-1042: SPRNLQPQRAALAPSFVEFDMSVEGYGCLFIPTLST → FPACWKPNIWKDNLAQKPVAGDAAQCNIFPPASSVL
     1043-3184: Missing.

Show »
Length:1,042
Mass (Da):114,924
Checksum:i534C48ABE2A94BB1
GO
Isoform 4 (identifier: Q6ZS81-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     3111-3184: RPAGEEPPAQ...GRIFCWSADG → LQMGRKREAA...QPSPWPMGLL

Note: No experimental confirmation available.
Show »
Length:3,176
Mass (Da):352,667
Checksum:iD7F5CFF17F2AADA1
GO
Isoform 5 (identifier: Q6ZS81-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2862-2920: DMYLFSLGSE...DFSCCLGSYG → GDSLAMHCLV...SRGVSSLGSV
     2921-3184: Missing.

Note: No experimental confirmation available.
Show »
Length:2,920
Mass (Da):325,232
Checksum:i73B0497433628D5D
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A1W2PQ91A0A1W2PQ91_HUMAN
WD repeat- and FYVE domain-containi...
WDFY4
77Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti1337A → G in BAB84911 (Ref. 4) Curated1
Sequence conflicti2595D → G in AAH47574 (PubMed:15489334).Curated1
Sequence conflicti2683E → K in AAH47574 (PubMed:15489334).Curated1
Sequence conflicti3118P → L in AAH47574 (PubMed:15489334).Curated1
Sequence conflicti3118P → L in BAB13433 (PubMed:10997877).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_027684214S → P1 PublicationCorresponds to variant dbSNP:rs7072606Ensembl.1
Natural variantiVAR_027685944S → F. Corresponds to variant dbSNP:rs12242384Ensembl.1
Natural variantiVAR_0472612527S → N3 PublicationsCorresponds to variant dbSNP:rs2663046Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_020750627 – 654SLLRI…LLSLL → VISSPPLRLASLWICTKRST FAQAFVFM in isoform 2. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_020751655 – 3184Missing in isoform 2. 1 PublicationAdd BLAST2530
Alternative sequenceiVSP_0356831007 – 1042SPRNL…PTLST → FPACWKPNIWKDNLAQKPVA GDAAQCNIFPPASSVL in isoform 3. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_0356841043 – 3184Missing in isoform 3. 1 PublicationAdd BLAST2142
Alternative sequenceiVSP_0356852862 – 2920DMYLF…LGSYG → GDSLAMHCLVSCPRVVPSVA GFLWRSSTTYLGKVLGTDFE WLHLQSQPDSRGVSSLGSV in isoform 5. 1 PublicationAdd BLAST59
Alternative sequenceiVSP_0356862921 – 3184Missing in isoform 5. 1 PublicationAdd BLAST264
Alternative sequenceiVSP_0356873111 – 3184RPAGE…WSADG → LQMGRKREAAEALAQQCQAE GGRGDWGLSSAYRRNPQGLL PHSSQGRASGNHSSAAQPSP WPMGLL in isoform 4. 1 PublicationAdd BLAST74

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK024502 mRNA Translation: BAB15792.1
AK127650 mRNA Translation: BAC87073.1
AC035139 Genomic DNA No translation available.
AC060234 Genomic DNA No translation available.
AC068898 Genomic DNA No translation available.
BC015694 mRNA Translation: AAH15694.2
BC034937 mRNA Translation: AAH34937.1
BC047574 mRNA Translation: AAH47574.1
AK074085 mRNA Translation: BAB84911.1
AB046827 mRNA Translation: BAB13433.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS44385.1 [Q6ZS81-1]

NCBI Reference Sequences

More...
RefSeqi
NP_065996.1, NM_020945.1 [Q6ZS81-1]
XP_005270061.1, XM_005270004.3 [Q6ZS81-1]
XP_011538290.1, XM_011539988.2 [Q6ZS81-1]
XP_016871952.1, XM_017016463.1 [Q6ZS81-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.287379

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000325239; ENSP00000320563; ENSG00000128815 [Q6ZS81-1]
ENST00000360890; ENSP00000354141; ENSG00000128815 [Q6ZS81-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
57705

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:57705

UCSC genome browser

More...
UCSCi
uc001jgy.3 human [Q6ZS81-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK024502 mRNA Translation: BAB15792.1
AK127650 mRNA Translation: BAC87073.1
AC035139 Genomic DNA No translation available.
AC060234 Genomic DNA No translation available.
AC068898 Genomic DNA No translation available.
BC015694 mRNA Translation: AAH15694.2
BC034937 mRNA Translation: AAH34937.1
BC047574 mRNA Translation: AAH47574.1
AK074085 mRNA Translation: BAB84911.1
AB046827 mRNA Translation: BAB13433.1
CCDSiCCDS44385.1 [Q6ZS81-1]
RefSeqiNP_065996.1, NM_020945.1 [Q6ZS81-1]
XP_005270061.1, XM_005270004.3 [Q6ZS81-1]
XP_011538290.1, XM_011539988.2 [Q6ZS81-1]
XP_016871952.1, XM_017016463.1 [Q6ZS81-1]
UniGeneiHs.287379

3D structure databases

ProteinModelPortaliQ6ZS81
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121729, 1 interactor
IntActiQ6ZS81, 2 interactors
STRINGi9606.ENSP00000320563

PTM databases

iPTMnetiQ6ZS81
PhosphoSitePlusiQ6ZS81

Polymorphism and mutation databases

BioMutaiWDFY4
DMDMi215274123

Proteomic databases

EPDiQ6ZS81
jPOSTiQ6ZS81
MaxQBiQ6ZS81
PaxDbiQ6ZS81
PeptideAtlasiQ6ZS81
PRIDEiQ6ZS81
ProteomicsDBi68196
68197 [Q6ZS81-2]
68198 [Q6ZS81-3]
68199 [Q6ZS81-4]
68200 [Q6ZS81-5]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000325239; ENSP00000320563; ENSG00000128815 [Q6ZS81-1]
ENST00000360890; ENSP00000354141; ENSG00000128815 [Q6ZS81-2]
GeneIDi57705
KEGGihsa:57705
UCSCiuc001jgy.3 human [Q6ZS81-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
57705
DisGeNETi57705
EuPathDBiHostDB:ENSG00000128815.17

GeneCards: human genes, protein and diseases

More...
GeneCardsi
WDFY4

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0018000
HGNCiHGNC:29323 WDFY4
HPAiHPA040634
MIMi613316 gene
neXtProtiNX_Q6ZS81
OpenTargetsiENSG00000128815
PharmGKBiPA134967634

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1786 Eukaryota
KOG1788 Eukaryota
ENOG410XNQC LUCA
GeneTreeiENSGT00940000155684
InParanoidiQ6ZS81
OMAiVVRHMSR
OrthoDBi101142at2759
PhylomeDBiQ6ZS81
TreeFamiTF313658

Enzyme and pathway databases

SignaLinkiQ6ZS81

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
WDFY4 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
57705

Protein Ontology

More...
PROi
PR:Q6ZS81

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000128815 Expressed in 147 organ(s), highest expression level in superficial temporal artery
ExpressionAtlasiQ6ZS81 baseline and differential
GenevisibleiQ6ZS81 HS

Family and domain databases

CDDicd06071 Beach, 1 hit
cd01201 PH_BEACH, 1 hit
Gene3Di1.10.1540.10, 1 hit
2.130.10.10, 1 hit
InterProiView protein in InterPro
IPR016024 ARM-type_fold
IPR000409 BEACH_dom
IPR036372 BEACH_dom_sf
IPR023362 PH-BEACH_dom
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
IPR036322 WD40_repeat_dom_sf
PfamiView protein in Pfam
PF02138 Beach, 1 hit
PF00400 WD40, 2 hits
SMARTiView protein in SMART
SM01026 Beach, 1 hit
SM00320 WD40, 5 hits
SUPFAMiSSF48371 SSF48371, 2 hits
SSF50978 SSF50978, 1 hit
SSF81837 SSF81837, 1 hit
PROSITEiView protein in PROSITE
PS50197 BEACH, 1 hit
PS51783 PH_BEACH, 1 hit
PS00678 WD_REPEATS_1, 1 hit
PS50082 WD_REPEATS_2, 2 hits
PS50294 WD_REPEATS_REGION, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiWDFY4_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6ZS81
Secondary accession number(s): B9ZVP2
, Q86WZ4, Q8N4A3, Q8TEN7, Q96BE1, Q9H7H8, Q9HCG5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: November 25, 2008
Last modified: February 13, 2019
This is version 126 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 10
    Human chromosome 10: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again