Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 137 (16 Jan 2019)
Sequence version 1 (05 Jul 2004)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Zinc finger protein 662

Gene

ZNF662

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in transcriptional regulation.By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri192 – 214C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri220 – 242C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri248 – 270C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri276 – 298C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri304 – 326C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri332 – 354C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri360 – 382C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri388 – 410C2H2-type 8PROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-212436 Generic Transcription Pathway

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger protein 662
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZNF662
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000182983.14

Human Gene Nomenclature Database

More...
HGNCi
HGNC:31930 ZNF662

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6ZS27

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000182983

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142670510

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ZNF662

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74758793

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002511961 – 426Zinc finger protein 662Add BLAST426

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6ZS27

PeptideAtlas

More...
PeptideAtlasi
Q6ZS27

PRoteomics IDEntifications database

More...
PRIDEi
Q6ZS27

ProteomicsDB human proteome resource

More...
ProteomicsDBi
68185
68186 [Q6ZS27-2]

Consortium for Top Down Proteomics

More...
TopDownProteomicsi
Q6ZS27-1 [Q6ZS27-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6ZS27

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6ZS27

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000182983 Expressed in 152 organ(s), highest expression level in vagina

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6ZS27 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6ZS27 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA039116
HPA040377

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
132979, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q6ZS27, 5 interactors

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q6ZS27

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6ZS27

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 44KRABPROSITE-ProRule annotationAdd BLAST44

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri192 – 214C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri220 – 242C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri248 – 270C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri276 – 298C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri304 – 326C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri332 – 354C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri360 – 382C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri388 – 410C2H2-type 8PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000163753

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000234617

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG018163

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6ZS27

KEGG Orthology (KO)

More...
KOi
K09228

Identification of Orthologs from Complete Genome Data

More...
OMAi
GSQEFWF

Database of Orthologous Groups

More...
OrthoDBi
1318335at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6ZS27

TreeFam database of animal gene trees

More...
TreeFami
TF342076

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR001909 KRAB
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00096 zf-C2H2, 7 hits

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00355 ZnF_C2H2, 8 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57667 SSF57667, 5 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50805 KRAB, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 8 hits
PS50157 ZINC_FINGER_C2H2_2, 8 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6ZS27-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLENYGAVAS LAAFPFPKPA LISQLERGET PWCSVPRGAL DGEAPRGISS
60 70 80 90 100
GYPFLKPAGI SHPEQVEEPL NLKLQGEGPS LICPEGVLKR KKEDFILKEE
110 120 130 140 150
IIEEAQDLMV LSSGPQWCGS QELWFGKTCE EKSRLGRWPG YLNGGRMESS
160 170 180 190 200
TNDIIEVIVK DEMISVEESS GNTDVNNLLG IHHKILNEQI FYICEECGKC
210 220 230 240 250
FDQNEDFDQH QKTHNGEKVY GCKECGKAFS FRSHCIAHQR IHSGVKPYEC
260 270 280 290 300
QECAKAFVWK SNLIRHQRIH TGEKPFECKE CGKGFSQNTS LTQHQRIHTG
310 320 330 340 350
EKPYTCKECG KSFTRNPALL RHQRMHTGEK PYECKDCGKG FMWNSDLSQH
360 370 380 390 400
QRVHTGDKPH ECTDCGKSFF CKAHLIRHQR IHTGERPYKC NDCGKAFSQN
410 420
SVLIKHQRRH ARDKPYNCQI SHLLEH
Length:426
Mass (Da):48,496
Last modified:July 5, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iC43690B7773AF3DE
GO
Isoform 2 (identifier: Q6ZS27-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     2-109: Missing.

Show »
Length:318
Mass (Da):36,759
Checksum:i32A942244CE1E0AF
GO
Isoform 3 (identifier: Q6ZS27-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MAAVALASGTRLGLVLELLPGQPALPRARRESVTFEDVAVYFSENEWIGLGPAQRALYRDVM
     12-12: Missing.
     51-84: Missing.

Note: No experimental confirmation available.
Show »
Length:452
Mass (Da):51,408
Checksum:iAE041F57CDF49740
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8WE97F8WE97_HUMAN
Zinc finger protein 662
ZNF662
106Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAI28086 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti389K → R in BAC87565 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_061961176N → S. Corresponds to variant dbSNP:rs60980399Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0537831M → MAAVALASGTRLGLVLELLP GQPALPRARRESVTFEDVAV YFSENEWIGLGPAQRALYRD VM in isoform 3. Curated1
Alternative sequenceiVSP_0207452 – 109Missing in isoform 2. 1 PublicationAdd BLAST108
Alternative sequenceiVSP_05378412Missing in isoform 3. Curated1
Alternative sequenceiVSP_05378551 – 84Missing in isoform 3. CuratedAdd BLAST34

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK127779 mRNA Translation: BAC87129.1
AK128676 mRNA Translation: BAC87565.1
AK131235 mRNA Translation: BAD18417.1
AC092043 Genomic DNA No translation available.
BC128085 mRNA Translation: AAI28086.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS2708.1 [Q6ZS27-1]
CCDS46807.1 [Q6ZS27-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001128128.1, NM_001134656.1 [Q6ZS27-3]
NP_997287.2, NM_207404.3 [Q6ZS27-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.720173

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000328199; ENSP00000329264; ENSG00000182983 [Q6ZS27-3]
ENST00000440367; ENSP00000405047; ENSG00000182983 [Q6ZS27-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
389114

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:389114

UCSC genome browser

More...
UCSCi
uc003cmi.3 human [Q6ZS27-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK127779 mRNA Translation: BAC87129.1
AK128676 mRNA Translation: BAC87565.1
AK131235 mRNA Translation: BAD18417.1
AC092043 Genomic DNA No translation available.
BC128085 mRNA Translation: AAI28086.1 Different initiation.
CCDSiCCDS2708.1 [Q6ZS27-1]
CCDS46807.1 [Q6ZS27-3]
RefSeqiNP_001128128.1, NM_001134656.1 [Q6ZS27-3]
NP_997287.2, NM_207404.3 [Q6ZS27-1]
UniGeneiHs.720173

3D structure databases

ProteinModelPortaliQ6ZS27
SMRiQ6ZS27
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi132979, 3 interactors
IntActiQ6ZS27, 5 interactors

PTM databases

iPTMnetiQ6ZS27
PhosphoSitePlusiQ6ZS27

Polymorphism and mutation databases

BioMutaiZNF662
DMDMi74758793

Proteomic databases

jPOSTiQ6ZS27
PeptideAtlasiQ6ZS27
PRIDEiQ6ZS27
ProteomicsDBi68185
68186 [Q6ZS27-2]
TopDownProteomicsiQ6ZS27-1 [Q6ZS27-1]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000328199; ENSP00000329264; ENSG00000182983 [Q6ZS27-3]
ENST00000440367; ENSP00000405047; ENSG00000182983 [Q6ZS27-1]
GeneIDi389114
KEGGihsa:389114
UCSCiuc003cmi.3 human [Q6ZS27-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
389114
EuPathDBiHostDB:ENSG00000182983.14

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ZNF662
HGNCiHGNC:31930 ZNF662
HPAiHPA039116
HPA040377
neXtProtiNX_Q6ZS27
OpenTargetsiENSG00000182983
PharmGKBiPA142670510

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00940000163753
HOGENOMiHOG000234617
HOVERGENiHBG018163
InParanoidiQ6ZS27
KOiK09228
OMAiGSQEFWF
OrthoDBi1318335at2759
PhylomeDBiQ6ZS27
TreeFamiTF342076

Enzyme and pathway databases

ReactomeiR-HSA-212436 Generic Transcription Pathway

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
389114

Protein Ontology

More...
PROi
PR:Q6ZS27

Gene expression databases

BgeeiENSG00000182983 Expressed in 152 organ(s), highest expression level in vagina
ExpressionAtlasiQ6ZS27 baseline and differential
GenevisibleiQ6ZS27 HS

Family and domain databases

InterProiView protein in InterPro
IPR001909 KRAB
IPR036236 Znf_C2H2_sf
IPR013087 Znf_C2H2_type
PfamiView protein in Pfam
PF00096 zf-C2H2, 7 hits
SMARTiView protein in SMART
SM00355 ZnF_C2H2, 8 hits
SUPFAMiSSF57667 SSF57667, 5 hits
PROSITEiView protein in PROSITE
PS50805 KRAB, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 8 hits
PS50157 ZINC_FINGER_C2H2_2, 8 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZN662_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6ZS27
Secondary accession number(s): A1A4T9
, F8W7S8, Q6ZNF8, Q6ZQW8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 3, 2006
Last sequence update: July 5, 2004
Last modified: January 16, 2019
This is version 137 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again