Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rho GTPase-activating protein 36

Gene

ARHGAP36

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

GTPase activator for the Rho-type GTPases by converting them to an inactive GDP-bound state.By similarity

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionGTPase activation

Enzyme and pathway databases

ReactomeiR-HSA-194840 Rho GTPase cycle

Names & Taxonomyi

Protein namesi
Recommended name:
Rho GTPase-activating protein 36
Gene namesi
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

EuPathDBiHostDB:ENSG00000147256.10
HGNCiHGNC:26388 ARHGAP36
MIMi300937 gene
neXtProtiNX_Q6ZRI8

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Organism-specific databases

DisGeNETi158763
OpenTargetsiENSG00000147256
PharmGKBiPA165756384

Polymorphism and mutation databases

BioMutaiARHGAP36
DMDMi74722974

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 40Sequence analysisAdd BLAST40
ChainiPRO_000025669941 – 547Rho GTPase-activating protein 36Add BLAST507

Proteomic databases

PaxDbiQ6ZRI8
PeptideAtlasiQ6ZRI8
PRIDEiQ6ZRI8
ProteomicsDBi68137
68138 [Q6ZRI8-2]
68139 [Q6ZRI8-3]
68140 [Q6ZRI8-4]
68141 [Q6ZRI8-5]
TopDownProteomicsiQ6ZRI8-1 [Q6ZRI8-1]

PTM databases

iPTMnetiQ6ZRI8
PhosphoSitePlusiQ6ZRI8

Expressioni

Gene expression databases

BgeeiENSG00000147256 Expressed in 88 organ(s), highest expression level in pituitary gland
ExpressionAtlasiQ6ZRI8 baseline and differential
GenevisibleiQ6ZRI8 HS

Organism-specific databases

HPAiHPA002064

Interactioni

Protein-protein interaction databases

BioGridi127703, 16 interactors
STRINGi9606.ENSP00000276211

Structurei

3D structure databases

ProteinModelPortaliQ6ZRI8
SMRiQ6ZRI8
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini226 – 426Rho-GAPPROSITE-ProRule annotationAdd BLAST201

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi149 – 185Arg-richAdd BLAST37

Keywords - Domaini

Signal

Phylogenomic databases

eggNOGiKOG2710 Eukaryota
ENOG410YVI5 LUCA
GeneTreeiENSGT00760000119123
HOVERGENiHBG056228
InParanoidiQ6ZRI8
KOiK20648
OMAiEFKPDRA
OrthoDBiEOG091G0849
PhylomeDBiQ6ZRI8
TreeFamiTF316710

Family and domain databases

Gene3Di1.10.555.10, 1 hit
InterProiView protein in InterPro
IPR008936 Rho_GTPase_activation_prot
IPR037863 RHOGAP6/36
IPR000198 RhoGAP_dom
PANTHERiPTHR12635 PTHR12635, 2 hits
PfamiView protein in Pfam
PF00620 RhoGAP, 1 hit
SMARTiView protein in SMART
SM00324 RhoGAP, 1 hit
SUPFAMiSSF48350 SSF48350, 1 hit
PROSITEiView protein in PROSITE
PS50238 RHOGAP, 1 hit

Sequences (5+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6ZRI8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGGCIPFLKA ARALCPRIMP PLLLLSAFIF LVSVLGGAPG HNPDRRTKMV
60 70 80 90 100
SIHSLSELER LKLQETAYHE LVARHFLSEF KPDRALPIDR PNTLDKWFLI
110 120 130 140 150
LRGQQRAVSH KTFGISLEEV LVNEFTRRKH LELTATMQVE EATGQAAGRR
160 170 180 190 200
RGNVVRRVFG RIRRFFSRRR NEPTLPREFT RRGRRGAVSV DSLAELEDGA
210 220 230 240 250
LLLQTLQLSK ISFPIGQRLL GSKRKMSLNP IAKQIPQVVE ACCQFIEKHG
260 270 280 290 300
LSAVGIFTLE YSVQRVRQLR EEFDQGLDVV LDDNQNVHDV AALLKEFFRD
310 320 330 340 350
MKDSLLPDDL YMSFLLTATL KPQDQLSALQ LLVYLMPPCH SDTLERLLKA
360 370 380 390 400
LHKITENCED SIGIDGQLVP GNRMTSTNLA LVFGSALLKK GKFGKRESRK
410 420 430 440 450
TKLGIDHYVA SVNVVRAMID NWDVLFQVPP HIQRQVAKRV WKSSPEALDF
460 470 480 490 500
IRRRNLRKIQ SARIKMEEDA LLSDPVETSA EARAAVLAQS KPSDEGSSEE
510 520 530 540
PAVPSGTARS HDDEEGAGNP PIPEQDRPLL RVPREKEAKT GVSYFFP
Length:547
Mass (Da):61,664
Last modified:July 5, 2004 - v1
Checksum:i28EB8168F3928DF9
GO
Isoform 2 (identifier: Q6ZRI8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MGGCIPFLKAARALCPRIMPPLLLLSAFIFLV → M

Show »
Length:516
Mass (Da):58,340
Checksum:i15B94C6E4A812CD8
GO
Isoform 3 (identifier: Q6ZRI8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-136: Missing.

Note: No experimental confirmation available.
Show »
Length:411
Mass (Da):46,230
Checksum:i58C7DFD0D4CE3822
GO
Isoform 4 (identifier: Q6ZRI8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: MGGCIPFLKAARALCPRIMPPLLLLSAFIFL → MAWILDCLFASAFEPRPRR

Note: No experimental confirmation available.
Show »
Length:535
Mass (Da):60,570
Checksum:iA2B54A40702F287F
GO
Isoform 5 (identifier: Q6ZRI8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: Missing.

Note: No experimental confirmation available.
Show »
Length:499
Mass (Da):56,565
Checksum:i0D1D47E6A5A25B29
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
X6RIA0X6RIA0_HUMAN
Rho GTPase-activating protein 36
ARHGAP36
218Annotation score:

Sequence cautioni

The sequence AAH63790 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti340H → R in BAH12425 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0213571 – 136Missing in isoform 3. 1 PublicationAdd BLAST136
Alternative sequenceiVSP_0392351 – 48Missing in isoform 5. 1 PublicationAdd BLAST48
Alternative sequenceiVSP_0213581 – 32MGGCI…FIFLV → M in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_0392361 – 31MGGCI…AFIFL → MAWILDCLFASAFEPRPRR in isoform 4. 1 PublicationAdd BLAST31

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK054620 mRNA Translation: BAB70776.1
AK128203 mRNA Translation: BAC87322.1
AK294274 mRNA Translation: BAH11720.1
AK296748 mRNA Translation: BAH12425.1
AL590131 Genomic DNA No translation available.
CH471107 Genomic DNA Translation: EAX11793.1
BC063790 mRNA Translation: AAH63790.1 Different initiation.
CCDSiCCDS14628.1 [Q6ZRI8-1]
CCDS65320.1 [Q6ZRI8-4]
CCDS83489.1 [Q6ZRI8-3]
RefSeqiNP_001269536.1, NM_001282607.1 [Q6ZRI8-4]
NP_001317580.1, NM_001330651.1 [Q6ZRI8-3]
NP_659404.2, NM_144967.3 [Q6ZRI8-1]
XP_011529582.1, XM_011531280.1 [Q6ZRI8-3]
UniGeneiHs.22905

Genome annotation databases

EnsembliENST00000276211; ENSP00000276211; ENSG00000147256 [Q6ZRI8-1]
ENST00000370921; ENSP00000359959; ENSG00000147256 [Q6ZRI8-3]
ENST00000370922; ENSP00000359960; ENSG00000147256 [Q6ZRI8-4]
ENST00000412432; ENSP00000408515; ENSG00000147256 [Q6ZRI8-2]
ENST00000639280; ENSP00000492307; ENSG00000147256 [Q6ZRI8-3]
GeneIDi158763
KEGGihsa:158763
UCSCiuc004evz.5 human [Q6ZRI8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK054620 mRNA Translation: BAB70776.1
AK128203 mRNA Translation: BAC87322.1
AK294274 mRNA Translation: BAH11720.1
AK296748 mRNA Translation: BAH12425.1
AL590131 Genomic DNA No translation available.
CH471107 Genomic DNA Translation: EAX11793.1
BC063790 mRNA Translation: AAH63790.1 Different initiation.
CCDSiCCDS14628.1 [Q6ZRI8-1]
CCDS65320.1 [Q6ZRI8-4]
CCDS83489.1 [Q6ZRI8-3]
RefSeqiNP_001269536.1, NM_001282607.1 [Q6ZRI8-4]
NP_001317580.1, NM_001330651.1 [Q6ZRI8-3]
NP_659404.2, NM_144967.3 [Q6ZRI8-1]
XP_011529582.1, XM_011531280.1 [Q6ZRI8-3]
UniGeneiHs.22905

3D structure databases

ProteinModelPortaliQ6ZRI8
SMRiQ6ZRI8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127703, 16 interactors
STRINGi9606.ENSP00000276211

PTM databases

iPTMnetiQ6ZRI8
PhosphoSitePlusiQ6ZRI8

Polymorphism and mutation databases

BioMutaiARHGAP36
DMDMi74722974

Proteomic databases

PaxDbiQ6ZRI8
PeptideAtlasiQ6ZRI8
PRIDEiQ6ZRI8
ProteomicsDBi68137
68138 [Q6ZRI8-2]
68139 [Q6ZRI8-3]
68140 [Q6ZRI8-4]
68141 [Q6ZRI8-5]
TopDownProteomicsiQ6ZRI8-1 [Q6ZRI8-1]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000276211; ENSP00000276211; ENSG00000147256 [Q6ZRI8-1]
ENST00000370921; ENSP00000359959; ENSG00000147256 [Q6ZRI8-3]
ENST00000370922; ENSP00000359960; ENSG00000147256 [Q6ZRI8-4]
ENST00000412432; ENSP00000408515; ENSG00000147256 [Q6ZRI8-2]
ENST00000639280; ENSP00000492307; ENSG00000147256 [Q6ZRI8-3]
GeneIDi158763
KEGGihsa:158763
UCSCiuc004evz.5 human [Q6ZRI8-1]

Organism-specific databases

CTDi158763
DisGeNETi158763
EuPathDBiHostDB:ENSG00000147256.10
GeneCardsiARHGAP36
HGNCiHGNC:26388 ARHGAP36
HPAiHPA002064
MIMi300937 gene
neXtProtiNX_Q6ZRI8
OpenTargetsiENSG00000147256
PharmGKBiPA165756384
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2710 Eukaryota
ENOG410YVI5 LUCA
GeneTreeiENSGT00760000119123
HOVERGENiHBG056228
InParanoidiQ6ZRI8
KOiK20648
OMAiEFKPDRA
OrthoDBiEOG091G0849
PhylomeDBiQ6ZRI8
TreeFamiTF316710

Enzyme and pathway databases

ReactomeiR-HSA-194840 Rho GTPase cycle

Miscellaneous databases

GenomeRNAii158763
PROiPR:Q6ZRI8
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000147256 Expressed in 88 organ(s), highest expression level in pituitary gland
ExpressionAtlasiQ6ZRI8 baseline and differential
GenevisibleiQ6ZRI8 HS

Family and domain databases

Gene3Di1.10.555.10, 1 hit
InterProiView protein in InterPro
IPR008936 Rho_GTPase_activation_prot
IPR037863 RHOGAP6/36
IPR000198 RhoGAP_dom
PANTHERiPTHR12635 PTHR12635, 2 hits
PfamiView protein in Pfam
PF00620 RhoGAP, 1 hit
SMARTiView protein in SMART
SM00324 RhoGAP, 1 hit
SUPFAMiSSF48350 SSF48350, 1 hit
PROSITEiView protein in PROSITE
PS50238 RHOGAP, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiRHG36_HUMAN
AccessioniPrimary (citable) accession number: Q6ZRI8
Secondary accession number(s): B7Z234
, B7Z439, Q5JRL9, Q5JRM0, Q5JRM1, Q96NU6
Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: July 5, 2004
Last modified: September 12, 2018
This is version 113 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again