Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 122 (07 Apr 2021)
Sequence version 2 (12 Dec 2006)
Previous versions | rss
Add a publicationFeedback
Protein

DNA replication ATP-dependent helicase/nuclease DNA2

Gene

Dna2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Key enzyme involved in DNA replication and DNA repair in nucleus and mitochondrion. Involved in Okazaki fragments processing by cleaving long flaps that escape FEN1: flaps that are longer than 27 nucleotides are coated by replication protein A complex (RPA), leading to recruit DNA2 which cleaves the flap until it is too short to bind RPA and becomes a substrate for FEN1. Also involved in 5'-end resection of DNA during double-strand break (DSB) repair: recruited by BLM and mediates the cleavage of 5'-ssDNA, while the 3'-ssDNA cleavage is prevented by the presence of RPA. Also involved in DNA replication checkpoint independently of Okazaki fragments processing. Possesses different enzymatic activities, such as single-stranded DNA (ssDNA)-dependent ATPase, 5'-3' helicase and endonuclease activities. While the ATPase and endonuclease activities are well-defined and play a key role in Okazaki fragments processing and DSB repair, the 5'-3' DNA helicase activity is subject to debate. According to various reports, the helicase activity is weak and its function remains largely unclear. Helicase activity may promote the motion of DNA2 on the flap, helping the nuclease function (By similarity).By similarity

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>This subsection of the 'Function' section provides information relevant to cofactors. A cofactor is any non-protein substance required for a protein to be catalytically active. Some cofactors are inorganic, such as the metal atoms zinc, iron, and copper in various oxidation states. Others, such as most vitamins, are organic.<p><a href='/help/cofactor' target='_top'>More...</a></p>Cofactori

[4Fe-4S] clusterBy similarityNote: Binds 1 [4Fe-4S] cluster.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section indicates at which position the protein binds a given metal ion. The nature of the metal is indicated in the 'Description' field.<p><a href='/help/metal' target='_top'>More...</a></p>Metal bindingi137Iron-sulfur (4Fe-4S)By similarity1
Metal bindingi394Iron-sulfur (4Fe-4S)By similarity1
Metal bindingi397Iron-sulfur (4Fe-4S)By similarity1
Metal bindingi403Iron-sulfur (4Fe-4S)By similarity1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi649 – 656ATPSequence analysis8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding, Endonuclease, Helicase, Hydrolase, Multifunctional enzyme, Nuclease
Biological processDNA damage, DNA repair, DNA replication
Ligand4Fe-4S, ATP-binding, Iron, Iron-sulfur, Metal-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-174437, Removal of the Flap Intermediate from the C-strand
R-MMU-5685938, HDR through Single Strand Annealing (SSA)
R-MMU-5685942, HDR through Homologous Recombination (HRR)
R-MMU-5693568, Resolution of D-loop Structures through Holliday Junction Intermediates
R-MMU-5693579, Homologous DNA Pairing and Strand Exchange
R-MMU-5693607, Processing of DNA double-strand break ends
R-MMU-5693616, Presynaptic phase of homologous DNA pairing and strand exchange
R-MMU-6804756, Regulation of TP53 Activity through Phosphorylation
R-MMU-69166, Removal of the Flap Intermediate
R-MMU-69473, G2/M DNA damage checkpoint

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
DNA replication ATP-dependent helicase/nuclease DNA2
Alternative name(s):
DNA replication ATP-dependent helicase-like homolog
Including the following 2 domains:
DNA replication nuclease DNA2 (EC:3.1.-.-)
DNA replication ATP-dependent helicase DNA2 (EC:3.6.4.12)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Dna2
Synonyms:Dna2l, Kiaa0083
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 10

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2443732, Dna2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Mitochondrion, Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002636041 – 1062DNA replication ATP-dependent helicase/nuclease DNA2Add BLAST1062

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Acetylated by EP300, leading to stimulate the 5'-3' endonuclease, the 5'-3' helicase and DNA-dependent ATPase activities, possibly by increasing DNA substrate affinity.By similarity

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q6ZQJ5

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6ZQJ5

PeptideAtlas

More...
PeptideAtlasi
Q6ZQJ5

PRoteomics IDEntifications database

More...
PRIDEi
Q6ZQJ5

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
279738 [Q6ZQJ5-1]
279739 [Q6ZQJ5-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6ZQJ5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6ZQJ5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000036875, Expressed in lumbar subsegment of spinal cord and 238 other tissues

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6ZQJ5, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with BLM and WDHD1.

By similarity

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
236484, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q6ZQJ5, 2 interactors

Molecular INTeraction database

More...
MINTi
Q6ZQJ5

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000115750

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q6ZQJ5, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11062
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6ZQJ5

Database of comparative protein structure models

More...
ModBasei
Search...

Protein Data Bank in Europe - Knowledge Base

More...
PDBe-KBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni82 – 520Nuclease activityBy similarityAdd BLAST439
Regioni521 – 1062Helicase activityBy similarityAdd BLAST542

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the DNA2/NAM7 helicase family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1805, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00780000122010

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_001666_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6ZQJ5

Identification of Orthologs from Complete Genome Data

More...
OMAi
IEEDIWS

Database of Orthologous Groups

More...
OrthoDBi
633768at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6ZQJ5

TreeFam database of animal gene trees

More...
TreeFami
TF314903

Family and domain databases

Conserved Domains Database

More...
CDDi
cd18808, SF1_C_Upf1, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR026851, Dna2
IPR041679, DNA2/NAM7-like_C
IPR041677, DNA2/NAM7_AAA_11
IPR014808, DNA_replication_fac_Dna2_N
IPR027417, P-loop_NTPase

The PANTHER Classification System

More...
PANTHERi
PTHR10887:SF433, PTHR10887:SF433, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF13086, AAA_11, 2 hits
PF13087, AAA_12, 1 hit
PF08696, Dna2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF52540, SSF52540, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q6ZQJ5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEPLDELDLL LLEEDGGAEA VPRVELLRKK ADALFPETVL SRGVDNRYLV
60 70 80 90 100
LAVETSQNER GAEEKRLHVT ASQDREHEVL CILRNGWSSV PVEPGDIVHL
110 120 130 140 150
EGDCTSEPWI IDDDFGYFIL YPDMMISGTS VASSIRCLRR AVLSETFRGS
160 170 180 190 200
DPATRQMLIG TILHEVFQKA ISESFAPERL QELALQTLRE VRHLKEMYRL
210 220 230 240 250
NLSQDEILCE VEEYLPSFSK WAEDFMRKGP SSEFPQMQLS LPSDGSNRSS
260 270 280 290 300
PCNIEVVKSL DIEESIWSPR FGLKGKIDVT VGVKIHRDCK MKYKVMPLEL
310 320 330 340 350
KTGKESNSIE HRSQVVLYTL LSQERREDPE AGWLLYLKTG QMYPVPANHL
360 370 380 390 400
DKRELLKLRN WLAASLLHRV SRAAPGEEAR LSALPQIIEE EKTCKYCSQI
410 420 430 440 450
GNCALYSRAV EEQGDDASIP EAMLSKIQEE TRHLQLAHLK YFSLWCLMLT
460 470 480 490 500
LESQSKDNRK THQSIWLTPA SELEESGNCV GNLVRTEPVS RVCDGQYLHN
510 520 530 540 550
FQRKNGPMPA TNLMAGDRII LSGEERKLFA LSKGYVKKMN KAAVTCLLDR
560 570 580 590 600
NLSTLPATTV FRLDREERHG DISTPLGNLS KLMESTDPSK RLRELIIDFR
610 620 630 640 650
EPQFIAYLSS VLPHDAKDTV ANILKGLNKP QRQAMKRVLL SKDYTLIVGM
660 670 680 690 700
PGTGKTTTIC ALVRILSACG FSVLLTSYTH SAVDNILLKL AKFKVGFLRL
710 720 730 740 750
GQSHKVHPDI QKFTEEEICR SRSIASLAHL EELYNSHPIV ATTCMGINHP
760 770 780 790 800
IFSRKTFDFC IVDEASQISQ PVCLGPLFFS RRFVLVGDHQ QLPPLVVNRE
810 820 830 840 850
ARALGMSESL FKRLERNESA VVQLTVQYRM NRKIMSLSNK LTYAGKLECG
860 870 880 890 900
SDRVANAVLA LPNLKDARLS LQLYADYSDS PWLAGVLEPD NPVCFLNTDK
910 920 930 940 950
VPAPEQVENG GVSNVTEARL IVFLTSTFIK AGCSPSDIGV IAPYRQQLRI
960 970 980 990 1000
ISDLLARSSV GMVEVNTVDK YQGRDKSLIL VSFVRSNEDG TLGELLKDWR
1010 1020 1030 1040 1050
RLNVALTRAK HKLILLGSVS SLKRFPPLGT LFDHLNAEQL ILDLPSREHE
1060
SLSHILGDCQ RD
Length:1,062
Mass (Da):119,447
Last modified:December 12, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iCD009CB89ACA775C
GO
Isoform 2 (identifier: Q6ZQJ5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     932-966: GCSPSDIGVIAPYRQQLRIISDLLARSSVGMVEVN → AAPQTLASSPRTDSSCGSSATYWPGLLLGWLRLTQ
     967-1062: Missing.

Show »
Length:966
Mass (Da):108,508
Checksum:iC3C38997DFB65AE9
GO

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC97861 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti285I → K in BAC25919 (PubMed:16141072).Curated1
Sequence conflicti375P → L in AAH25182 (PubMed:15489334).Curated1
Sequence conflicti400I → M in AAH25182 (PubMed:15489334).Curated1
Sequence conflicti486T → M in AAH25182 (PubMed:15489334).Curated1
Sequence conflicti543A → V in AAH25182 (PubMed:15489334).Curated1
Sequence conflicti881P → S in AAH25182 (PubMed:15489334).Curated1
Sequence conflicti957R → Q in AAH25182 (PubMed:15489334).Curated1
Sequence conflicti1037A → T in AAH25182 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_021872932 – 966GCSPS…MVEVN → AAPQTLASSPRTDSSCGSSA TYWPGLLLGWLRLTQ in isoform 2. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_021873967 – 1062Missing in isoform 2. 1 PublicationAdd BLAST96

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK129051 mRNA Translation: BAC97861.1 Different initiation.
AK028381 mRNA Translation: BAC25919.1
BC025182 mRNA Translation: AAH25182.1
BC115716 mRNA Translation: AAI15717.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS35923.1 [Q6ZQJ5-1]

NCBI Reference Sequences

More...
RefSeqi
NP_796346.2, NM_177372.3 [Q6ZQJ5-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000092462; ENSMUSP00000090119; ENSMUSG00000036875 [Q6ZQJ5-2]
ENSMUST00000131422; ENSMUSP00000115750; ENSMUSG00000036875 [Q6ZQJ5-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
327762

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:327762

UCSC genome browser

More...
UCSCi
uc007fji.2, mouse [Q6ZQJ5-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK129051 mRNA Translation: BAC97861.1 Different initiation.
AK028381 mRNA Translation: BAC25919.1
BC025182 mRNA Translation: AAH25182.1
BC115716 mRNA Translation: AAI15717.1
CCDSiCCDS35923.1 [Q6ZQJ5-1]
RefSeqiNP_796346.2, NM_177372.3 [Q6ZQJ5-1]

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
5EANX-ray2.36A1-1056[»]
5EAWX-ray3.00A/B1-1056[»]
5EAXX-ray3.05A/B1-1056[»]
SMRiQ6ZQJ5
ModBaseiSearch...
PDBe-KBiSearch...

Protein-protein interaction databases

BioGRIDi236484, 3 interactors
IntActiQ6ZQJ5, 2 interactors
MINTiQ6ZQJ5
STRINGi10090.ENSMUSP00000115750

PTM databases

iPTMnetiQ6ZQJ5
PhosphoSitePlusiQ6ZQJ5

Proteomic databases

EPDiQ6ZQJ5
PaxDbiQ6ZQJ5
PeptideAtlasiQ6ZQJ5
PRIDEiQ6ZQJ5
ProteomicsDBi279738 [Q6ZQJ5-1]
279739 [Q6ZQJ5-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
28503, 141 antibodies

Genome annotation databases

EnsembliENSMUST00000092462; ENSMUSP00000090119; ENSMUSG00000036875 [Q6ZQJ5-2]
ENSMUST00000131422; ENSMUSP00000115750; ENSMUSG00000036875 [Q6ZQJ5-1]
GeneIDi327762
KEGGimmu:327762
UCSCiuc007fji.2, mouse [Q6ZQJ5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
1763
MGIiMGI:2443732, Dna2

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG1805, Eukaryota
GeneTreeiENSGT00780000122010
HOGENOMiCLU_001666_2_0_1
InParanoidiQ6ZQJ5
OMAiIEEDIWS
OrthoDBi633768at2759
PhylomeDBiQ6ZQJ5
TreeFamiTF314903

Enzyme and pathway databases

ReactomeiR-MMU-174437, Removal of the Flap Intermediate from the C-strand
R-MMU-5685938, HDR through Single Strand Annealing (SSA)
R-MMU-5685942, HDR through Homologous Recombination (HRR)
R-MMU-5693568, Resolution of D-loop Structures through Holliday Junction Intermediates
R-MMU-5693579, Homologous DNA Pairing and Strand Exchange
R-MMU-5693607, Processing of DNA double-strand break ends
R-MMU-5693616, Presynaptic phase of homologous DNA pairing and strand exchange
R-MMU-6804756, Regulation of TP53 Activity through Phosphorylation
R-MMU-69166, Removal of the Flap Intermediate
R-MMU-69473, G2/M DNA damage checkpoint

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
327762, 21 hits in 53 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Dna2, mouse

Protein Ontology

More...
PROi
PR:Q6ZQJ5
RNActiQ6ZQJ5, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000036875, Expressed in lumbar subsegment of spinal cord and 238 other tissues
GenevisibleiQ6ZQJ5, MM

Family and domain databases

CDDicd18808, SF1_C_Upf1, 1 hit
InterProiView protein in InterPro
IPR026851, Dna2
IPR041679, DNA2/NAM7-like_C
IPR041677, DNA2/NAM7_AAA_11
IPR014808, DNA_replication_fac_Dna2_N
IPR027417, P-loop_NTPase
PANTHERiPTHR10887:SF433, PTHR10887:SF433, 1 hit
PfamiView protein in Pfam
PF13086, AAA_11, 2 hits
PF13087, AAA_12, 1 hit
PF08696, Dna2, 1 hit
SUPFAMiSSF52540, SSF52540, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDNA2_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6ZQJ5
Secondary accession number(s): Q14BM9, Q8BSZ0, Q8R3J3
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: December 12, 2006
Last sequence update: December 12, 2006
Last modified: April 7, 2021
This is version 122 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again