Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

PHD finger protein 21A

Gene

Phf21a

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Component of the BHC complex, a corepressor complex that represses transcription of neuron-specific genes in non-neuronal cells. The BHC complex is recruited at RE1/NRSE sites by REST and acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier. In the BHC complex, it may act as a scaffold. Inhibits KDM1A-mediated demethylation of 'Lys-4' of histone H3 in vitro, suggesting a role in demethylation regulation (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi405 – 417A.T hookBy similarityAdd BLAST13
Zinc fingeri468 – 515PHD-typePROSITE-ProRule annotationAdd BLAST48

GO - Molecular functioni

  • chromatin binding Source: MGI
  • DNA binding Source: UniProtKB-KW
  • metal ion binding Source: UniProtKB-KW

GO - Biological processi

  • chromatin organization Source: UniProtKB-KW
  • negative regulation of transcription by RNA polymerase II Source: MGI
  • suckling behavior Source: MGI

Keywordsi

Molecular functionChromatin regulator, DNA-binding, Repressor
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
PHD finger protein 21A
Alternative name(s):
BHC80a
BRAF35-HDAC complex protein BHC80
Short name:
mBHC80
Gene namesi
Name:Phf21a
Synonyms:Bhc80, Kiaa1696, Pftf1
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:2384756 Phf21a

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002267681 – 659PHD finger protein 21AAdd BLAST659

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Cross-linki65Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
Modified residuei424PhosphothreonineBy similarity1
Modified residuei427PhosphoserineBy similarity1

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

PeptideAtlasiQ6ZPK0
PRIDEiQ6ZPK0

PTM databases

iPTMnetiQ6ZPK0
PhosphoSitePlusiQ6ZPK0

Expressioni

Tissue specificityi

Expressed in the brain and testis. Weakly or not expressed in other tissues tested. Localized throughout the central nervous system (CNS) in brain, including the cerebellum, hippocampus, and cortex. Notably present in neuronal cells of granular cell layer and dentate gyrus in cerebellum and hippocampus, respectively. In the seminiferous tubules, the signals it is present strongly in spermatocytes, and weakly in spermatogonia and round spermatids. In some cases, it is also observed solely in spermatocytes (at protein level).1 Publication

Gene expression databases

CleanExiMM_PHF21A

Interactioni

Subunit structurei

Component of a BHC histone deacetylase complex that contains HDAC1, HDAC2, HMG20B/BRAF35, KDM1A, RCOR1/CoREST and PHF21A/BHC80. The BHC complex may also contain ZMYM2, ZNF217, ZMYM3, GSE1 and GTF2I. In the complex, it interacts directly with HDAC1, HDAC2, HMG20B/BRAF35, KDM1A and RCOR1/CoREST (By similarity).By similarity

Protein-protein interaction databases

BioGridi228685, 1 interactor

Structurei

3D structure databases

ProteinModelPortaliQ6ZPK0
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Coiled coili538 – 582Sequence analysisAdd BLAST45

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi4 – 116Gln-richAdd BLAST113

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri468 – 515PHD-typePROSITE-ProRule annotationAdd BLAST48

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

HOGENOMiHOG000231466
HOVERGENiHBG080293
InParanoidiQ6ZPK0

Family and domain databases

Gene3Di3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR019786 Zinc_finger_PHD-type_CS
IPR011011 Znf_FYVE_PHD
IPR001965 Znf_PHD
IPR019787 Znf_PHD-finger
IPR013083 Znf_RING/FYVE/PHD
PfamiView protein in Pfam
PF00628 PHD, 1 hit
SMARTiView protein in SMART
SM00249 PHD, 1 hit
SUPFAMiSSF57903 SSF57903, 1 hit
PROSITEiView protein in PROSITE
PS01359 ZF_PHD_1, 1 hit
PS50016 ZF_PHD_2, 1 hit

Sequences (9+)i

Sequence statusi: Complete.

This entry describes 9 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 9 described isoforms and 15 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6ZPK0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MELQTLQEAL KVEIQVHQKL VAQMKQDPQN ADLKKQLHEL QAKITALSEK
60 70 80 90 100
QKRVVEQLRK NLIVKQEQPD KFQIQPLSQS ENKLQTAQQQ PLQPLQQQQP
110 120 130 140 150
QQPQQQQQQQ QQHAQQSAAA PPSLTASQKT VTTASMITTK TLPLVLKAAT
160 170 180 190 200
ATMPASVVGQ RPTIAMVTAI NSQKAVLSTD VQNTPVNLQT SSKVTGPGAE
210 220 230 240 250
AVQIVAKNTV TLQVQATPPQ PIKVPQFIPP PRLTPRPNFL PQVRPKPVAQ
260 270 280 290 300
NNIPIAPAPP PMLAAPQLIQ RPVMLTKFTP TTLPTSQNSI HPVRVVNGQT
310 320 330 340 350
ATIAKTFPMA QLTSIVIATP GTRLAGPQTV QLSKPSLEKQ LNPTQKQRKN
360 370 380 390 400
KQGLVTHDHL EEIQSKRQER KRRTTANPVY SGAVFEPERK KSAVTYLNST
410 420 430 440 450
MHPGTRKRGR PPKYNAVLGF GALTPTSPPS SHPDSPENEK TETTFTFPAP
460 470 480 490 500
VQPVSLPSPT STDGDIHEDF CSVCRKSGQL LMCDTCSRVY HLDCLEPPLK
510 520 530 540 550
TIPKGMWICP RCQDQMLKKE EAIPWPGTLA IVHSYIAYKA AKEEEKQKLL
560 570 580 590 600
KWSSDLKQER EQLEQKVKEL SSSISKCMEM KSSILARQKE MRSSLDKVKR
610 620 630 640 650
LIRLVHGVDL CRPVDSEATA GALSNGPDCT PPANAASTPA PSPSSQSCTA

NCNQGEETK
Length:659
Mass (Da):72,521
Last modified:March 7, 2006 - v2
Checksum:iE0EECD3F02CCFF78
GO
Isoform 2 (identifier: Q6ZPK0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     129-212: Missing.
     341-352: LNPTQKQRKNKQ → TVKSHPEAEEKQAESRTVTPPAAPKPKREENPQKLAFMVSL

Show »
Length:604
Mass (Da):67,037
Checksum:i7665C91ED1BAC6A8
GO
Isoform 3 (identifier: Q6ZPK0-3) [UniParc]FASTAAdd to basket
Also known as: BHC80-6(AIF2+5)

The sequence of this isoform differs from the canonical sequence as follows:
     129-129: Missing.

Show »
Length:658
Mass (Da):72,393
Checksum:iF5903B7237BBBA86
GO
Isoform 4 (identifier: Q6ZPK0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     128-212: Missing.
     341-352: LNPTQKQRKNKQ → TVKSHPEAEEKQAESRTVTPPAAPKPKREENPQKLAFMVSL
     409-463: GRPPKYNAVLGFGALTPTSPPSSHPDSPENEKTETTFTFPAPVQPVSLPSPTSTD → ANEEHWPK

Show »
Length:556
Mass (Da):62,168
Checksum:i764F551F8AD5720F
GO
Isoform 5 (identifier: Q6ZPK0-5) [UniParc]FASTAAdd to basket
Also known as: BHC80-1(AIF1+3)

The sequence of this isoform differs from the canonical sequence as follows:
     128-212: Missing.
     409-463: GRPPKYNAVLGFGALTPTSPPSSHPDSPENEKTETTFTFPAPVQPVSLPSPTSTD → ANEEHWPK

Show »
Length:527
Mass (Da):59,092
Checksum:iCC4E08129A9721E8
GO
Isoform 6 (identifier: Q6ZPK0-6) [UniParc]FASTAAdd to basket
Also known as: BHC80-4(AIF2+3)

The sequence of this isoform differs from the canonical sequence as follows:
     129-129: Missing.
     409-463: GRPPKYNAVLGFGALTPTSPPSSHPDSPENEKTETTFTFPAPVQPVSLPSPTSTD → ANEEHWPK

Show »
Length:611
Mass (Da):67,652
Checksum:iA7BB50EF790E4540
GO
Isoform 7 (identifier: Q6ZPK0-7) [UniParc]FASTAAdd to basket
Also known as: BHC80-2(AIF1+4)

The sequence of this isoform differs from the canonical sequence as follows:
     128-212: Missing.
     409-452: GRPPKYNAVLGFGALTPTSPPSSHPDSPENEKTETTFTFPAPVQ → ANEEHWPK

Show »
Length:538
Mass (Da):60,174
Checksum:i0F9B23394047C9EB
GO
Isoform 8 (identifier: Q6ZPK0-8) [UniParc]FASTAAdd to basket
Also known as: BHC80-5(AIF2+4)

The sequence of this isoform differs from the canonical sequence as follows:
     129-129: Missing.
     409-452: GRPPKYNAVLGFGALTPTSPPSSHPDSPENEKTETTFTFPAPVQ → ANEEHWPK

Show »
Length:622
Mass (Da):68,734
Checksum:i1D5A57648E4DDA9B
GO
Isoform 9 (identifier: Q6ZPK0-9) [UniParc]FASTAAdd to basket
Also known as: BHC80-3(AIF1+5)

The sequence of this isoform differs from the canonical sequence as follows:
     128-212: Missing.

Show »
Length:574
Mass (Da):63,833
Checksum:iC115A3BB54D6E748
GO

Computationally mapped potential isoform sequencesi

There are 15 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A2AHG2A2AHG2_MOUSE
PHD finger protein 21A
Phf21a
688Annotation score:
A2AHG4A2AHG4_MOUSE
PHD finger protein 21A
Phf21a
641Annotation score:
A2AHG3A2AHG3_MOUSE
PHD finger protein 21A
Phf21a
556Annotation score:
D3Z764D3Z764_MOUSE
PHD finger protein 21A
Phf21a
604Annotation score:
F6URE6F6URE6_MOUSE
PHD finger protein 21A
Phf21a
575Annotation score:
E9PV92E9PV92_MOUSE
PHD finger protein 21A
Phf21a
611Annotation score:
E9QKW9E9QKW9_MOUSE
PHD finger protein 21A
Phf21a
659Annotation score:
F6TKP4F6TKP4_MOUSE
PHD finger protein 21A
Phf21a
231Annotation score:
F6TL54F6TL54_MOUSE
PHD finger protein 21A
Phf21a
189Annotation score:
E0CYN5E0CYN5_MOUSE
PHD finger protein 21A
Phf21a
71Annotation score:
There are more potential isoformsShow all

Sequence cautioni

The sequence BAC98234 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti325A → P in BAC65327 (PubMed:15325272).Curated1
Sequence conflicti325A → P in BAC29735 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_017450128 – 212Missing in isoform 4, isoform 5, isoform 7 and isoform 9. 2 PublicationsAdd BLAST85
Alternative sequenceiVSP_017451129 – 212Missing in isoform 2. 1 PublicationAdd BLAST84
Alternative sequenceiVSP_017452129Missing in isoform 3, isoform 6 and isoform 8. 2 Publications1
Alternative sequenceiVSP_017453341 – 352LNPTQ…RKNKQ → TVKSHPEAEEKQAESRTVTP PAAPKPKREENPQKLAFMVS L in isoform 2 and isoform 4. 3 PublicationsAdd BLAST12
Alternative sequenceiVSP_017454409 – 463GRPPK…PTSTD → ANEEHWPK in isoform 4, isoform 5 and isoform 6. 2 PublicationsAdd BLAST55
Alternative sequenceiVSP_017455409 – 452GRPPK…PAPVQ → ANEEHWPK in isoform 7 and isoform 8. 1 PublicationAdd BLAST44

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB105178 mRNA Translation: BAC65327.1
AK129424 Transcribed RNA Translation: BAC98234.1 Different initiation.
AK037174 mRNA Translation: BAC29735.1
BC019181 mRNA Translation: AAH19181.1
AY206982 mRNA Translation: AAP43962.1
CCDSiCCDS16442.1 [Q6ZPK0-4]
CCDS50645.1 [Q6ZPK0-2]
RefSeqiNP_001103161.1, NM_001109691.1
NP_620094.2, NM_138755.2
XP_006499043.1, XM_006498980.3
XP_017172037.1, XM_017316548.1
UniGeneiMm.330408

Genome annotation databases

GeneIDi192285
KEGGimmu:192285

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB105178 mRNA Translation: BAC65327.1
AK129424 Transcribed RNA Translation: BAC98234.1 Different initiation.
AK037174 mRNA Translation: BAC29735.1
BC019181 mRNA Translation: AAH19181.1
AY206982 mRNA Translation: AAP43962.1
CCDSiCCDS16442.1 [Q6ZPK0-4]
CCDS50645.1 [Q6ZPK0-2]
RefSeqiNP_001103161.1, NM_001109691.1
NP_620094.2, NM_138755.2
XP_006499043.1, XM_006498980.3
XP_017172037.1, XM_017316548.1
UniGeneiMm.330408

3D structure databases

ProteinModelPortaliQ6ZPK0
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi228685, 1 interactor

PTM databases

iPTMnetiQ6ZPK0
PhosphoSitePlusiQ6ZPK0

Proteomic databases

PeptideAtlasiQ6ZPK0
PRIDEiQ6ZPK0

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

GeneIDi192285
KEGGimmu:192285

Organism-specific databases

CTDi51317
MGIiMGI:2384756 Phf21a
RougeiSearch...

Phylogenomic databases

HOGENOMiHOG000231466
HOVERGENiHBG080293
InParanoidiQ6ZPK0

Miscellaneous databases

ChiTaRSiPhf21a mouse
PROiPR:Q6ZPK0
SOURCEiSearch...

Gene expression databases

CleanExiMM_PHF21A

Family and domain databases

Gene3Di3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR019786 Zinc_finger_PHD-type_CS
IPR011011 Znf_FYVE_PHD
IPR001965 Znf_PHD
IPR019787 Znf_PHD-finger
IPR013083 Znf_RING/FYVE/PHD
PfamiView protein in Pfam
PF00628 PHD, 1 hit
SMARTiView protein in SMART
SM00249 PHD, 1 hit
SUPFAMiSSF57903 SSF57903, 1 hit
PROSITEiView protein in PROSITE
PS01359 ZF_PHD_1, 1 hit
PS50016 ZF_PHD_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiPF21A_MOUSE
AccessioniPrimary (citable) accession number: Q6ZPK0
Secondary accession number(s): Q6XVG0
, Q80Z33, Q8CAZ4, Q8VEC8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 7, 2006
Last sequence update: March 7, 2006
Last modified: November 7, 2018
This is version 116 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again