Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 128 (12 Aug 2020)
Sequence version 3 (08 May 2019)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

PHD finger protein 21A

Gene

Phf21a

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Component of the BHC complex, a corepressor complex that represses transcription of neuron-specific genes in non-neuronal cells. The BHC complex is recruited at RE1/NRSE sites by REST and acts by deacetylating and demethylating specific sites on histones, thereby acting as a chromatin modifier. In the BHC complex, it may act as a scaffold. Inhibits KDM1A-mediated demethylation of 'Lys-4' of histone H3 in vitro, suggesting a role in demethylation regulation (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position and type of each DNA-binding domain present within the protein.<p><a href='/help/dna_bind' target='_top'>More...</a></p>DNA bindingi434 – 446A.T hookBy similarityAdd BLAST13
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri497 – 544PHD-typePROSITE-ProRule annotationAdd BLAST48

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionChromatin regulator, DNA-binding, Repressor
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-983231, Factors involved in megakaryocyte development and platelet production

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
PHD finger protein 21ACurated
Alternative name(s):
BHC80a
BRAF35-HDAC complex protein BHC80
Short name:
mBHC80
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Phf21aImported
Synonyms:Bhc80, Kiaa1696, Pftf1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Unplaced

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2384756, Phf21a

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002267681 – 688PHD finger protein 21AAdd BLAST688

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki65Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)By similarity
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei453PhosphothreonineBy similarity1
Modified residuei456PhosphoserineBy similarity1

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6ZPK0

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6ZPK0

PeptideAtlas

More...
PeptideAtlasi
Q6ZPK0

PRoteomics IDEntifications database

More...
PRIDEi
Q6ZPK0

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6ZPK0

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6ZPK0

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in the brain and testis. Weakly or not expressed in other tissues tested. Localized throughout the central nervous system (CNS) in brain, including the cerebellum, hippocampus, and cortex. Notably present in neuronal cells of granular cell layer and dentate gyrus in cerebellum and hippocampus, respectively. In the seminiferous tubules, the signals it is present strongly in spermatocytes, and weakly in spermatogonia and round spermatids. In some cases, it is also observed solely in spermatocytes (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000058318, Expressed in undifferentiated genital tubercle and 285 other tissues

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of a BHC histone deacetylase complex that contains HDAC1, HDAC2, HMG20B/BRAF35, KDM1A, RCOR1/CoREST and PHF21A/BHC80. The BHC complex may also contain ZMYM2, ZNF217, ZMYM3, GSE1 and GTF2I. In the complex, it interacts directly with HDAC1, HDAC2, HMG20B/BRAF35, KDM1A and RCOR1/CoREST (By similarity).

By similarity

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
228685, 2 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000088074

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q6ZPK0, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6ZPK0

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili571 – 609Sequence analysisAdd BLAST39

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi4 – 116Gln-richAdd BLAST113

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri497 – 544PHD-typePROSITE-ProRule annotationAdd BLAST48

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0383, Eukaryota

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6ZPK0

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6ZPK0

TreeFam database of animal gene trees

More...
TreeFami
TF331518

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR019786, Zinc_finger_PHD-type_CS
IPR011011, Znf_FYVE_PHD
IPR001965, Znf_PHD
IPR019787, Znf_PHD-finger
IPR013083, Znf_RING/FYVE/PHD

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00628, PHD, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00249, PHD, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF57903, SSF57903, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01359, ZF_PHD_1, 1 hit
PS50016, ZF_PHD_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (9+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 9 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 9 described isoforms and 15 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6ZPK0-10) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MELQTLQEAL KVEIQVHQKL VAQMKQDPQN ADLKKQLHEL QAKITALSEK
60 70 80 90 100
QKRVVEQLRK NLIVKQEQPD KFQIQPLSQS ENKLQTAQQQ PLQPLQQQQP
110 120 130 140 150
QQPQQQQQQQ QQHAQQSAAA PPSLTASQKT VTTASMITTK TLPLVLKAAT
160 170 180 190 200
ATMPASVVGQ RPTIAMVTAI NSQKAVLSTD VQNTPVNLQT SSKVTGPGAE
210 220 230 240 250
AVQIVAKNTV TLQVQATPPQ PIKVPQFIPP PRLTPRPNFL PQVRPKPVAQ
260 270 280 290 300
NNIPIAPAPP PMLAAPQLIQ RPVMLTKFTP TTLPTSQNSI HPVRVVNGQT
310 320 330 340 350
ATIAKTFPMA QLTSIVIATP GTRLAGPQTV QLSKPSLEKQ TVKSHPEAEE
360 370 380 390 400
KQAESRTVTP PAAPKPKREE NPQKLAFMVS LGLVTHDHLE EIQSKRQERK
410 420 430 440 450
RRTTANPVYS GAVFEPERKK SAVTYLNSTM HPGTRKRGRP PKYNAVLGFG
460 470 480 490 500
ALTPTSPPSS HPDSPENEKT ETTFTFPAPV QPVSLPSPTS TDGDIHEDFC
510 520 530 540 550
SVCRKSGQLL MCDTCSRVYH LDCLEPPLKT IPKGMWICPR CQDQMLKKEE
560 570 580 590 600
AIPWPGTLAI VHSYIAYKAA KEEEKQKLLK WSSDLKQERE QLEQKVKELS
610 620 630 640 650
SSISKCMEMK SSILARQKEM RSSLDKVKRL IRLVHGVDLC RPVDSEATAG
660 670 680
ALSNGPDCTP PANAASTPAP SPSSQSCTAN CNQGEETK
Length:688
Mass (Da):75,597
Last modified:May 8, 2019 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i187A2BC69E7E2A5C
GO
Isoform 2 (identifier: Q6ZPK0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     129-212: Missing.

Show »
Length:604
Mass (Da):67,037
Checksum:i7665C91ED1BAC6A8
GO
Isoform 3 (identifier: Q6ZPK0-3) [UniParc]FASTAAdd to basket
Also known as: BHC80-6(AIF2+5)

The sequence of this isoform differs from the canonical sequence as follows:
     129-129: Missing.
     341-381: Missing.

Show »
Length:646
Mass (Da):70,929
Checksum:i553D51A832AE2A13
GO
Isoform 4 (identifier: Q6ZPK0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     129-213: Missing.
     438-492: GRPPKYNAVLGFGALTPTSPPSSHPDSPENEKTETTFTFPAPVQPVSLPSPTSTD → ANEEHWPK

Show »
Length:556
Mass (Da):62,168
Checksum:i764F551F8AD5720F
GO
Isoform 5 (identifier: Q6ZPK0-5) [UniParc]FASTAAdd to basket
Also known as: BHC80-1(AIF1+3)

The sequence of this isoform differs from the canonical sequence as follows:
     129-213: Missing.
     341-381: Missing.
     438-492: GRPPKYNAVLGFGALTPTSPPSSHPDSPENEKTETTFTFPAPVQPVSLPSPTSTD → ANEEHWPK

Show »
Length:515
Mass (Da):57,627
Checksum:i0947C11F4A729C75
GO
Isoform 6 (identifier: Q6ZPK0-6) [UniParc]FASTAAdd to basket
Also known as: BHC80-4(AIF2+3)

The sequence of this isoform differs from the canonical sequence as follows:
     129-129: Missing.
     341-381: Missing.
     438-492: GRPPKYNAVLGFGALTPTSPPSSHPDSPENEKTETTFTFPAPVQPVSLPSPTSTD → ANEEHWPK

Show »
Length:599
Mass (Da):66,187
Checksum:i6401549F3DC2BC3A
GO
Isoform 7 (identifier: Q6ZPK0-7) [UniParc]FASTAAdd to basket
Also known as: BHC80-2(AIF1+4)

The sequence of this isoform differs from the canonical sequence as follows:
     129-213: Missing.
     341-381: Missing.
     438-481: GRPPKYNAVLGFGALTPTSPPSSHPDSPENEKTETTFTFPAPVQ → ANEEHWPK

Show »
Length:526
Mass (Da):58,710
Checksum:iD03A92233CCFF3B4
GO
Isoform 8 (identifier: Q6ZPK0-8) [UniParc]FASTAAdd to basket
Also known as: BHC80-5(AIF2+4)

The sequence of this isoform differs from the canonical sequence as follows:
     129-129: Missing.
     341-381: Missing.
     438-481: GRPPKYNAVLGFGALTPTSPPSSHPDSPENEKTETTFTFPAPVQ → ANEEHWPK

Show »
Length:610
Mass (Da):67,269
Checksum:i55626FC0A5AB5BF1
GO
Isoform 9 (identifier: Q6ZPK0-9) [UniParc]FASTAAdd to basket
Also known as: BHC80-3(AIF1+5)

The sequence of this isoform differs from the canonical sequence as follows:
     129-213: Missing.
     341-381: Missing.

Show »
Length:562
Mass (Da):62,369
Checksum:i8FD659D365F7F8F9
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 15 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A498WGG5A0A498WGG5_MOUSE
PHD finger protein 21A
Phf21a
688Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2AHG4A2AHG4_MOUSE
PHD finger protein 21A
Phf21a
641Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D3Z764D3Z764_MOUSE
PHD finger protein 21A
Phf21a
604Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PV92E9PV92_MOUSE
PHD finger protein 21A
Phf21a
611Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2AHG3A2AHG3_MOUSE
PHD finger protein 21A
Phf21a
556Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6TKP4F6TKP4_MOUSE
PHD finger protein 21A
Phf21a
231Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6URE6F6URE6_MOUSE
PHD finger protein 21A
Phf21a
575Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9QKW9E9QKW9_MOUSE
PHD finger protein 21A
Phf21a
659Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6U6L3F6U6L3_MOUSE
PHD finger protein 21A
Phf21a
185Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F6TL54F6TL54_MOUSE
PHD finger protein 21A
Phf21a
189Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC98234 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti325A → P in BAC65327 (PubMed:15325272).Curated1
Sequence conflicti325A → P in BAC29735 (PubMed:16141072).Curated1
Sequence conflicti341Missing in BAC98234 (PubMed:14621295).Curated1
Sequence conflicti669A → T in BAC65327 (PubMed:15325272).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_060156129 – 213Missing in isoform 4, isoform 5, isoform 7 and isoform 9. Add BLAST85
Alternative sequenceiVSP_060157129 – 212Missing in isoform 2. Add BLAST84
Alternative sequenceiVSP_060158129Missing in isoform 3, isoform 6 and isoform 8. 1
Alternative sequenceiVSP_060159341 – 381Missing in isoform 3, isoform 5, isoform 6, isoform 7, isoform 9 and isoform 8. Add BLAST41
Alternative sequenceiVSP_060160438 – 492GRPPK…PTSTD → ANEEHWPK in isoform 6, isoform 5 and isoform 4. Add BLAST55
Alternative sequenceiVSP_060161438 – 481GRPPK…PAPVQ → ANEEHWPK in isoform 7 and isoform 8. Add BLAST44

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AB105178 mRNA Translation: BAC65327.1
AK129424 Transcribed RNA Translation: BAC98234.1 Frameshift.
AK037174 mRNA Translation: BAC29735.1
AL691462 Genomic DNA No translation available.
AL731709 Genomic DNA No translation available.
AL732484 Genomic DNA No translation available.
BC019181 mRNA Translation: AAH19181.1
AY206982 mRNA Translation: AAP43962.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS16442.1 [Q6ZPK0-4]
CCDS50644.1 [Q6ZPK0-10]
CCDS50645.1 [Q6ZPK0-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001103161.1, NM_001109691.1
NP_620094.2, NM_138755.2
XP_006499043.1, XM_006498980.3
XP_017172037.1, XM_017316548.1

Genome annotation databases

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
192285

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:192285

UCSC genome browser

More...
UCSCi
uc008kxl.2, mouse

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB105178 mRNA Translation: BAC65327.1
AK129424 Transcribed RNA Translation: BAC98234.1 Frameshift.
AK037174 mRNA Translation: BAC29735.1
AL691462 Genomic DNA No translation available.
AL731709 Genomic DNA No translation available.
AL732484 Genomic DNA No translation available.
BC019181 mRNA Translation: AAH19181.1
AY206982 mRNA Translation: AAP43962.1
CCDSiCCDS16442.1 [Q6ZPK0-4]
CCDS50644.1 [Q6ZPK0-10]
CCDS50645.1 [Q6ZPK0-2]
RefSeqiNP_001103161.1, NM_001109691.1
NP_620094.2, NM_138755.2
XP_006499043.1, XM_006498980.3
XP_017172037.1, XM_017316548.1

3D structure databases

SMRiQ6ZPK0
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi228685, 2 interactors
STRINGi10090.ENSMUSP00000088074

PTM databases

iPTMnetiQ6ZPK0
PhosphoSitePlusiQ6ZPK0

Proteomic databases

jPOSTiQ6ZPK0
PaxDbiQ6ZPK0
PeptideAtlasiQ6ZPK0
PRIDEiQ6ZPK0

Genome annotation databases

GeneIDi192285
KEGGimmu:192285
UCSCiuc008kxl.2, mouse

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51317
MGIiMGI:2384756, Phf21a

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG0383, Eukaryota
InParanoidiQ6ZPK0
PhylomeDBiQ6ZPK0
TreeFamiTF331518

Enzyme and pathway databases

ReactomeiR-MMU-983231, Factors involved in megakaryocyte development and platelet production

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
192285, 1 hit in 22 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Phf21a, mouse

Protein Ontology

More...
PROi
PR:Q6ZPK0
RNActiQ6ZPK0, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000058318, Expressed in undifferentiated genital tubercle and 285 other tissues

Family and domain databases

Gene3Di3.30.40.10, 1 hit
InterProiView protein in InterPro
IPR019786, Zinc_finger_PHD-type_CS
IPR011011, Znf_FYVE_PHD
IPR001965, Znf_PHD
IPR019787, Znf_PHD-finger
IPR013083, Znf_RING/FYVE/PHD
PfamiView protein in Pfam
PF00628, PHD, 1 hit
SMARTiView protein in SMART
SM00249, PHD, 1 hit
SUPFAMiSSF57903, SSF57903, 1 hit
PROSITEiView protein in PROSITE
PS01359, ZF_PHD_1, 1 hit
PS50016, ZF_PHD_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiPF21A_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6ZPK0
Secondary accession number(s): A2AHG2
, Q6XVG0, Q80Z33, Q8CAZ4, Q8VEC8
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 7, 2006
Last sequence update: May 8, 2019
Last modified: August 12, 2020
This is version 128 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again