Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Due to a server migration, the UniProt 'ID mapping', 'Peptide search' and 'community bibliography submission' tools will not be available on the 19th April 2021 during the morning (EST).

UniProtKB - Q6ZN11 (ZN793_HUMAN)

Entry version 145 (07 Apr 2021)
Sequence version 2 (24 Jul 2013)
Previous versions | rss
Add a publicationFeedback
Protein

Zinc finger protein 793

Gene

ZNF793

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri227 – 249C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri255 – 277C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri283 – 305C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri311 – 333C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri339 – 361C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri367 – 389C2H2-type 6PROSITE-ProRule annotationAdd BLAST23

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q6ZN11

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-212436, Generic Transcription Pathway

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Zinc finger protein 793
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ZNF793
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 19

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:33115, ZNF793

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q6ZN11

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000188227.12

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		390927

Open Targets

More...OpenTargetsi		ENSG00000188227

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA162410548

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q6ZN11, Tdark

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		ZNF793

Domain mapping of disease mutations (DMDM)

More...DMDMi		527504072

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002936991 – 406Zinc finger protein 793Add BLAST406

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q6ZN11

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q6ZN11

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q6ZN11

PeptideAtlas

More...PeptideAtlasi		Q6ZN11

PRoteomics IDEntifications database

More...PRIDEi		Q6ZN11

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		20354
67954 [Q6ZN11-1]
67955 [Q6ZN11-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q6ZN11

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q6ZN11

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000188227, Expressed in cerebellum and 225 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q6ZN11, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q6ZN11, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000188227, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		133738, 2 interactors

Protein interaction database and analysis system

More...IntActi		Q6ZN11, 2 interactors

Molecular INTeraction database

More...MINTi		Q6ZN11

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000396402

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q6ZN11, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q6ZN11

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini8 – 79KRABPROSITE-ProRule annotationAdd BLAST72

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the krueppel C2H2-type zinc-finger protein family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri227 – 249C2H2-type 1PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri255 – 277C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri283 – 305C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri311 – 333C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri339 – 361C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri367 – 389C2H2-type 6PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG1721, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000163141

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_002678_0_9_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q6ZN11

Identification of Orthologs from Complete Genome Data

More...OMAi		PALMYKP

Database of Orthologous Groups

More...OrthoDBi		1318335at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q6ZN11

TreeFam database of animal gene trees

More...TreeFami		TF340838

Family and domain databases

Conserved Domains Database

More...CDDi		cd07765, KRAB_A-box, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR001909, KRAB
IPR036051, KRAB_dom_sf
IPR036236, Znf_C2H2_sf
IPR013087, Znf_C2H2_type

Pfam protein domain database

More...Pfami		View protein in Pfam
PF01352, KRAB, 1 hit
PF00096, zf-C2H2, 6 hits

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00349, KRAB, 1 hit
SM00355, ZnF_C2H2, 6 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF109640, SSF109640, 1 hit
SSF57667, SSF57667, 3 hits

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50805, KRAB, 1 hit
PS00028, ZINC_FINGER_C2H2_1, 6 hits
PS50157, ZINC_FINGER_C2H2_2, 6 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6ZN11-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MIEYQIPVSF KDVVVGFTQE EWHRLSPAQR ALYRDVMLET YSNLVSVGYE 
        60         70         80         90        100
GTKPDVILRL EQEEAPWIGE AACPGCHCWE DIWRVNIQRK RRQDMLLRPG 
       110        120        130        140        150
AAISKKTLPK EKSCEYNKFG KISLLSTDLF SSIQSPSNWN PCGKNLNHNL 
       160        170        180        190        200
DLIGFKRNCA KKQDECYAYG KLLQRINHGR RPNGEKPRGC SHCEKAFTQN 
       210        220        230        240        250
PALMYKPAVS DSLLYKRKRV PPTEKPHVCS ECGKAFCYKS EFIRHQRSHT 
       260        270        280        290        300
GEKPYGCTDC GKAFSHKSTL IKHQRIHTGV RPFECFFCGK AFTQKSHRTE 
       310        320        330        340        350
HQRTHTGERP FVCSECGKSF GEKSYLNVHR KMHTGERPYR CRECGKSFSQ 
       360        370        380        390        400
KSCLNKHWRT HTGEKPYGCN ECGKAFYQKP NLSRHQKIHA RKNAYRNENL 

IIVGNT
Length:406
Mass (Da):46,927
Last modified:July 24, 2013 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i3A037ABF2ACBF1C2
GO
Isoform 2 (identifier: Q6ZN11-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     362-406: TGEKPYGCNECGKAFYQKPNLSRHQKIHARKNAYRNENLIIVGNT → FGESSLRSKSSNT

Show »
Length:374
Mass (Da):43,163
Checksum:iA13F9928372E8BAC
GO
Isoform 3 (identifier: Q6ZN11-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-94: Missing.

Show »
Length:312
Mass (Da):35,863
Checksum:i7CB985EF4E6D0521
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7EL37K7EL37_HUMAN
Zinc finger protein 793
ZNF793
83Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EMU0K7EMU0_HUMAN
Zinc finger protein 793
ZNF793
131Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EN11K7EN11_HUMAN
Zinc finger protein 793
ZNF793
138Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EQP3K7EQP3_HUMAN
Zinc finger protein 793
ZNF793
93Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ERJ7K7ERJ7_HUMAN
Zinc finger protein 793
ZNF793
53Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0A0MTM4A0A0A0MTM4_HUMAN
Zinc finger protein 793
ZNF793
305Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EMH8K7EMH8_HUMAN
Zinc finger protein 793
ZNF793
59Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAD97772 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti45V → A in BAD18564 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_03310768I → M. Corresponds to variant dbSNP:rs12977460Ensembl.1
Natural variantiVAR_061967133I → V. Corresponds to variant dbSNP:rs45593644Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0265641 – 94Missing in isoform 3. 1 PublicationAdd BLAST94
Alternative sequenceiVSP_026565362 – 406TGEKP…IVGNT → FGESSLRSKSSNT in isoform 2. 1 PublicationAdd BLAST45

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK131417 mRNA Translation: BAD18564.1
AC022148 Genomic DNA No translation available.
BX537524 mRNA Translation: CAD97772.1 Frameshift.

The Consensus CDS (CCDS) project

More...CCDSi		CCDS46062.1 [Q6ZN11-1]

NCBI Reference Sequences

More...RefSeqi		NP_001013681.2, NM_001013659.2 [Q6ZN11-1]
XP_005258984.1, XM_005258927.3 [Q6ZN11-1]
XP_006723276.1, XM_006723213.3 [Q6ZN11-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000445217; ENSP00000396402; ENSG00000188227 [Q6ZN11-1]
ENST00000587143; ENSP00000468605; ENSG00000188227 [Q6ZN11-1]
ENST00000627814; ENSP00000487183; ENSG00000188227 [Q6ZN11-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		390927

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:390927

UCSC genome browser

More...UCSCi		uc010xts.3, human [Q6ZN11-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK131417 mRNA Translation: BAD18564.1
AC022148 Genomic DNA No translation available.
BX537524 mRNA Translation: CAD97772.1 Frameshift.
CCDSiCCDS46062.1 [Q6ZN11-1]
RefSeqiNP_001013681.2, NM_001013659.2 [Q6ZN11-1]
XP_005258984.1, XM_005258927.3 [Q6ZN11-1]
XP_006723276.1, XM_006723213.3 [Q6ZN11-1]

3D structure databases

SMRiQ6ZN11
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi133738, 2 interactors
IntActiQ6ZN11, 2 interactors
MINTiQ6ZN11
STRINGi9606.ENSP00000396402

PTM databases

iPTMnetiQ6ZN11
PhosphoSitePlusiQ6ZN11

Genetic variation databases

BioMutaiZNF793
DMDMi527504072

Proteomic databases

MassIVEiQ6ZN11
MaxQBiQ6ZN11
PaxDbiQ6ZN11
PeptideAtlasiQ6ZN11
PRIDEiQ6ZN11
ProteomicsDBi20354
67954 [Q6ZN11-1]
67955 [Q6ZN11-2]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		29906, 40 antibodies

Genome annotation databases

EnsembliENST00000445217; ENSP00000396402; ENSG00000188227 [Q6ZN11-1]
ENST00000587143; ENSP00000468605; ENSG00000188227 [Q6ZN11-1]
ENST00000627814; ENSP00000487183; ENSG00000188227 [Q6ZN11-1]
GeneIDi390927
KEGGihsa:390927
UCSCiuc010xts.3, human [Q6ZN11-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		390927
DisGeNETi390927

GeneCards: human genes, protein and diseases

More...GeneCardsi		ZNF793
HGNCiHGNC:33115, ZNF793
HPAiENSG00000188227, Low tissue specificity
neXtProtiNX_Q6ZN11
OpenTargetsiENSG00000188227
PharmGKBiPA162410548
VEuPathDBiHostDB:ENSG00000188227.12

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG1721, Eukaryota
GeneTreeiENSGT00940000163141
HOGENOMiCLU_002678_0_9_1
InParanoidiQ6ZN11
OMAiPALMYKP
OrthoDBi1318335at2759
PhylomeDBiQ6ZN11
TreeFamiTF340838

Enzyme and pathway databases

PathwayCommonsiQ6ZN11
ReactomeiR-HSA-212436, Generic Transcription Pathway

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		390927, 6 hits in 1019 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		ZNF793, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		390927
PharosiQ6ZN11, Tdark

Protein Ontology

More...PROi		PR:Q6ZN11
RNActiQ6ZN11, protein

Gene expression databases

BgeeiENSG00000188227, Expressed in cerebellum and 225 other tissues
ExpressionAtlasiQ6ZN11, baseline and differential
GenevisibleiQ6ZN11, HS

Family and domain databases

CDDicd07765, KRAB_A-box, 1 hit
InterProiView protein in InterPro
IPR001909, KRAB
IPR036051, KRAB_dom_sf
IPR036236, Znf_C2H2_sf
IPR013087, Znf_C2H2_type
PfamiView protein in Pfam
PF01352, KRAB, 1 hit
PF00096, zf-C2H2, 6 hits
SMARTiView protein in SMART
SM00349, KRAB, 1 hit
SM00355, ZnF_C2H2, 6 hits
SUPFAMiSSF109640, SSF109640, 1 hit
SSF57667, SSF57667, 3 hits
PROSITEiView protein in PROSITE
PS50805, KRAB, 1 hit
PS00028, ZINC_FINGER_C2H2_1, 6 hits
PS50157, ZINC_FINGER_C2H2_2, 6 hits

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiZN793_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6ZN11
Secondary accession number(s): E9PGN4, Q7Z3Q9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: July 24, 2013
Last modified: April 7, 2021
This is version 145 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with genetic variants
    List of human entries with genetic variants
  3. Human variants curated from literature reports
    Index of human variants curated from literature reports
  4. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again