Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

WD repeat-containing protein 88

Gene

WDR88

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Enzyme and pathway databases

SignaLinkiQ6ZMY6

Names & Taxonomyi

Protein namesi
Recommended name:
WD repeat-containing protein 88
Alternative name(s):
PQQ repeat and WD repeat-containing protein
Gene namesi
Name:WDR88
Synonyms:PQWD
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000166359.10
HGNCiHGNC:26999 WDR88
neXtProtiNX_Q6ZMY6

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000166359
PharmGKBiPA162409139

Polymorphism and mutation databases

BioMutaiWDR88
DMDMi296453028

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002856301 – 472WD repeat-containing protein 88Add BLAST472

Proteomic databases

PaxDbiQ6ZMY6
PeptideAtlasiQ6ZMY6
PRIDEiQ6ZMY6
ProteomicsDBi67936
67937 [Q6ZMY6-2]

PTM databases

iPTMnetiQ6ZMY6
PhosphoSitePlusiQ6ZMY6

Expressioni

Gene expression databases

BgeeiENSG00000166359
CleanExiHS_WDR88
ExpressionAtlasiQ6ZMY6 baseline and differential
GenevisibleiQ6ZMY6 HS

Organism-specific databases

HPAiHPA041916
HPA050336

Interactioni

Protein-protein interaction databases

BioGridi125970, 1 interactor
IntActiQ6ZMY6, 14 interactors
STRINGi9606.ENSP00000348129

Structurei

3D structure databases

ProteinModelPortaliQ6ZMY6
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Repeati100 – 139WD 1Add BLAST40
Repeati143 – 182WD 2Add BLAST40
Repeati184 – 224WD 3Add BLAST41
Repeati228 – 267WD 4Add BLAST40
Repeati271 – 310WD 5Add BLAST40
Repeati319 – 358WD 6Add BLAST40
Repeati361 – 400WD 7Add BLAST40

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi452 – 458Poly-Ser7

Keywords - Domaini

Repeat, WD repeat

Phylogenomic databases

eggNOGiKOG0266 Eukaryota
ENOG410XP3K LUCA
GeneTreeiENSGT00920000149054
HOGENOMiHOG000169116
InParanoidiQ6ZMY6
OMAiACVTLMQ
OrthoDBiEOG091G0FFA
PhylomeDBiQ6ZMY6
TreeFamiTF300039

Family and domain databases

Gene3Di2.130.10.10, 3 hits
InterProiView protein in InterPro
IPR020472 G-protein_beta_WD-40_rep
IPR018391 PQQ_beta_propeller_repeat
IPR002372 PQQ_repeat
IPR011047 Quinoprotein_ADH-like_supfam
IPR015943 WD40/YVTN_repeat-like_dom_sf
IPR001680 WD40_repeat
IPR019775 WD40_repeat_CS
IPR017986 WD40_repeat_dom
PfamiView protein in Pfam
PF01011 PQQ, 1 hit
PF00400 WD40, 5 hits
PRINTSiPR00320 GPROTEINBRPT
SMARTiView protein in SMART
SM00564 PQQ, 1 hit
SM00320 WD40, 7 hits
SUPFAMiSSF50998 SSF50998, 1 hit
PROSITEiView protein in PROSITE
PS00678 WD_REPEATS_1, 5 hits
PS50082 WD_REPEATS_2, 6 hits
PS50294 WD_REPEATS_REGION, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q6ZMY6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASPPRCSPT AHDRECKLPP PSAPASEYCP GKLSWGTMAR ALGRFKLSIP
60 70 80 90 100
HTHLLATLDP LALDREPPPH LLPEKHQVPE KLIWGDQDPL SKIPFKILSG
110 120 130 140 150
HEHAVSTCHF CVDDTKLLSG SYDCTVKLWD PVDGSVVRDF EHRPKAPVVE
160 170 180 190 200
CSITGDSSRV IAASYDKTVR AWDLETGKLL WKVRYDTFIV SCKFSPDGKY
210 220 230 240 250
VVSGFDVDHG ICIMDAENIT TVSVIKDHHT RSITSCCFDP DSQRVASVSL
260 270 280 290 300
DRCIKIWDVT SQATLLTITK AHSNAISNCC FTFSGHFLCT SSWDKNLKIW
310 320 330 340 350
NVHTGEFRNC GACVTLMQGH EGSVSSCHFA RDSSFLISGG FDRTVAIWDV
360 370 380 390 400
AEGYRKLSLK GHNDWVMDVA ISNNKKWILS ASKDRTMRLW NIEEIDEIPL
410 420 430 440 450
VIKYKKAVGL KLKQCERCDR PFSIFKSDTS SEMFTQCVFC RIDTRGLPAD
460 470
TSSSSSSSER ENSPPPRGSK DD
Length:472
Mass (Da):52,621
Last modified:May 18, 2010 - v2
Checksum:iB525CCC29477F730
GO
Isoform 2 (identifier: Q6ZMY6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     415-472: CERCDRPFSIFKSDTSSEMFTQCVFCRIDTRGLPADTSSSSSSSERENSPPPRGSKDD → EKKEAYLKLKQG

Note: No experimental confirmation available.
Show »
Length:426
Mass (Da):47,617
Checksum:iC24E341B10CFDB51
GO

Sequence cautioni

The sequence AAH31227 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_035892166D → H in a breast cancer sample; somatic mutation. 1 Publication1
Natural variantiVAR_032030310C → R1 PublicationCorresponds to variant dbSNP:rs11881580Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_024873415 – 472CERCD…GSKDD → EKKEAYLKLKQG in isoform 2. 1 PublicationAdd BLAST58

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK131444 mRNA Translation: BAD18589.1
AC008738 Genomic DNA No translation available.
BC031227 mRNA Translation: AAH31227.2 Different initiation.
CCDSiCCDS12429.1 [Q6ZMY6-1]
RefSeqiNP_775750.3, NM_173479.3 [Q6ZMY6-1]
UniGeneiHs.211046

Genome annotation databases

EnsembliENST00000355868; ENSP00000348129; ENSG00000166359 [Q6ZMY6-1]
ENST00000361680; ENSP00000355148; ENSG00000166359 [Q6ZMY6-2]
GeneIDi126248
KEGGihsa:126248
UCSCiuc002nui.4 human [Q6ZMY6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiWDR88_HUMAN
AccessioniPrimary (citable) accession number: Q6ZMY6
Secondary accession number(s): Q8NEF8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 1, 2007
Last sequence update: May 18, 2010
Last modified: June 20, 2018
This is version 115 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health