Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 119 (02 Dec 2020)
Sequence version 1 (05 Jul 2004)
Previous versions | rss
Add a publicationFeedback
Protein

SPOC domain-containing protein 1

Gene

SPOCD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q6ZMY3

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
SPOC domain-containing protein 1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SPOCD1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 1

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...
EuPathDBi
HostDB:ENSG00000134668.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26338, SPOCD1

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6ZMY3

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
90853

Open Targets

More...
OpenTargetsi
ENSG00000134668

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134930231

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q6ZMY3, Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SPOCD1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74749560

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002874721 – 1216SPOC domain-containing protein 1Add BLAST1216

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6ZMY3

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q6ZMY3

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6ZMY3

PeptideAtlas

More...
PeptideAtlasi
Q6ZMY3

PRoteomics IDEntifications database

More...
PRIDEi
Q6ZMY3

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
67931 [Q6ZMY3-1]
67932 [Q6ZMY3-2]
67933 [Q6ZMY3-3]
67934 [Q6ZMY3-4]
67935 [Q6ZMY3-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6ZMY3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6ZMY3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000134668, Expressed in stromal cell of endometrium and 146 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6ZMY3, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6ZMY3, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000134668, Tissue enhanced (adipose tissue, urinary bladder)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
124772, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q6ZMY3, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000353670

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q6ZMY3, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6ZMY3

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini608 – 728TFIIS centralPROSITE-ProRule annotationAdd BLAST121
Domaini867 – 970SPOCAdd BLAST104

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1634, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000162194

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_029996_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6ZMY3

Identification of Orthologs from Complete Genome Data

More...
OMAi
ESLGGPC

Database of Orthologous Groups

More...
OrthoDBi
174961at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6ZMY3

TreeFam database of animal gene trees

More...
TreeFami
TF350578

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.472.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR012921, SPOC_C
IPR003618, TFIIS_cen_dom
IPR036575, TFIIS_cen_dom_sf

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07744, SPOC, 1 hit
PF07500, TFIIS_M, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00510, TFS2M, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46942, SSF46942, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51321, TFIIS_CENTRAL, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6ZMY3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSQAGDVEGP STGDPVLSPQ HNCELLQNME GASSMPGLSP DGPGASSGPG
60 70 80 90 100
VRAGSRRKIP RKEALRGGSS RAAGAAEVRP GVLELLAVVQ SRGSMLAPGL
110 120 130 140 150
HMQLPSVPTQ GRALTSKRLQ VSLCDILDDS CPRKLCSRSA GLPERALACR
160 170 180 190 200
ERLAGVEEVS CLRPREARDG GMSSPGCDRR SPTLSKEEPP GRPLTSSPDP
210 220 230 240 250
VPVRVRKKWR RQGAHSECEE GAGDFLWLDQ SPRGDNLLSV GDPPQVADLE
260 270 280 290 300
SLGGPCRPPS PKDTGSGPGE PGGSGAGCAS GTEKFGYLPA TGDGPQPGSP
310 320 330 340 350
CGPVGFPVPS GGESLSSAAQ APPQSAALCL GASAQASAEQ QEAVCVVRTG
360 370 380 390 400
SDEGQAPAQD QEELEAKAQP ASRGRLEQGL AAPADTCASS REPLGGLSSS
410 420 430 440 450
LDTEASRACS GPFMEQRRSK GTKNLKKGPV PCAQDRGTDR SSDNSHQDRP
460 470 480 490 500
EEPSPGGCPR LEEVKIPHGV KLVCYLGSGP VIQLLGAISH GQAGGQLPPK
510 520 530 540 550
LEVLEDLMEV SSPSPAQRLR RKKRPMVQGP AGCQVFQPSP SGGTAGDPGG
560 570 580 590 600
LSDPFYPPRS GSLALGDPSS DPACSQSGPM EAEEDSLPEQ PEDSAQLQQE
610 620 630 640 650
KPSLYIGVRG TVVRSMQEVL WTRLRELPDP VLSEEVVEGI AAGIEAALWD
660 670 680 690 700
LTQGTNGRYK TKYRSLLFNL RDPRNLDLFL KVVHGDVTPY DLVRMSSMQL
710 720 730 740 750
APQELARWRD QEEKRGLNII EQQQKEPCRL PASKMTHKGE VEIQRDMDQT
760 770 780 790 800
LTLEDLVGPQ MFMDCSPQAL PIASEDTTGQ HDHHFLDPNC HICKDWEPSN
810 820 830 840 850
ELLGSFEAAK SCGDNIFQKA LSQTPMPAPE MPKTRELSPT EPQDRVPPSG
860 870 880 890 900
LHVPAAPTKA LPCLPPWEGV LDMFSIKRFR ARAQLVSGHS CRLVQALPTV
910 920 930 940 950
IRSAGCIPSN IVWDLLASIC PAKAKDVCVV RLCPHGARDT QNCRLLYSYL
960 970 980 990 1000
NDRQRHGLAS VEHMGMVLLP LPAFQPLPTR LRPLGGPGLW ALPVSPLLSP
1010 1020 1030 1040 1050
GLEVTHSSLL LAVLLPKEGL PDTAGSSPWL GKVQKMVSFN SKVEKRYYQP
1060 1070 1080 1090 1100
DDRRPNVPLK GTPPPGGAWQ QSQGRGSIAP RGISAWQRPP RGRGRLWPEP
1110 1120 1130 1140 1150
ENWQHPGRGQ WPPEPGLRQS QHPYSVAPAG HGFGRGQHFH RDSCPHQALL
1160 1170 1180 1190 1200
RHLESLATMS HQLQALLCPQ TKSSIPRPLQ RLSSALAAPE PPGPARDSSL
1210
GPTDEAGSEC PFPRKA
Length:1,216
Mass (Da):130,027
Last modified:July 5, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i6887432C45E232DD
GO
Isoform 2 (identifier: Q6ZMY3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     987-999: Missing.

Show »
Length:1,203
Mass (Da):128,696
Checksum:i3E5A926523488717
GO
Isoform 3 (identifier: Q6ZMY3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-507: Missing.
     987-999: Missing.

Show »
Length:696
Mass (Da):76,557
Checksum:i2FA58952EFD93DFA
GO
Isoform 4 (identifier: Q6ZMY3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-656: Missing.
     657-676: GRYKTKYRSLLFNLRDPRNL → MLGWGSSFSVWCSPAPCPHQ
     758-788: GPQMFMDCSPQALPIASEDTTGQHDHHFLDP → VKLEPDLVLGRAHAWGSHASPHQQCGLGHVT
     789-1216: Missing.

Show »
Length:132
Mass (Da):14,920
Checksum:i33272EE51E9E44E9
GO
Isoform 5 (identifier: Q6ZMY3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     476-534: Missing.
     596-603: QLQQEKPS → FGSSRTQC
     604-1216: Missing.

Show »
Length:544
Mass (Da):55,893
Checksum:i259FFF524525EE0E
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0YF46H0YF46_HUMAN
SPOC domain-containing protein 1
SPOCD1
255Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PPM7E9PPM7_HUMAN
SPOC domain-containing protein 1
SPOCD1
639Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PMX0E9PMX0_HUMAN
SPOC domain-containing protein 1
SPOCD1
43Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PQH7E9PQH7_HUMAN
SPOC domain-containing protein 1
SPOCD1
20Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E9PKC3E9PKC3_HUMAN
SPOC domain-containing protein 1
SPOCD1
87Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH39870 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAB71652 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAC04981 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti549G → D in BAC04981 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_051379109T → A1 PublicationCorresponds to variant dbSNP:rs6664445Ensembl.1
Natural variantiVAR_051380436R → W. Corresponds to variant dbSNP:rs6669563Ensembl.1
Natural variantiVAR_035660671R → W in a breast cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs1165078436Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0254891 – 656Missing in isoform 4. 1 PublicationAdd BLAST656
Alternative sequenceiVSP_0254901 – 507Missing in isoform 3. 1 PublicationAdd BLAST507
Alternative sequenceiVSP_025491476 – 534Missing in isoform 5. 1 PublicationAdd BLAST59
Alternative sequenceiVSP_025492596 – 603QLQQEKPS → FGSSRTQC in isoform 5. 1 Publication8
Alternative sequenceiVSP_025493604 – 1216Missing in isoform 5. 1 PublicationAdd BLAST613
Alternative sequenceiVSP_025494657 – 676GRYKT…DPRNL → MLGWGSSFSVWCSPAPCPHQ in isoform 4. 1 PublicationAdd BLAST20
Alternative sequenceiVSP_025495758 – 788GPQMF…HFLDP → VKLEPDLVLGRAHAWGSHAS PHQQCGLGHVT in isoform 4. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_025496789 – 1216Missing in isoform 4. 1 PublicationAdd BLAST428
Alternative sequenceiVSP_025497987 – 999Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST13

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK058077 mRNA Translation: BAB71652.1 Different initiation.
AK091016 mRNA Translation: BAC03567.1
AK096192 mRNA Translation: BAC04722.1
AK097227 mRNA Translation: BAC04981.1 Different initiation.
AK131447 mRNA Translation: BAD18592.1
AL354919 Genomic DNA No translation available.
BC039870 mRNA Translation: AAH39870.1 Different initiation.
BC114430 mRNA Translation: AAI14431.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS347.1 [Q6ZMY3-1]
CCDS60066.1 [Q6ZMY3-2]
CCDS72748.1 [Q6ZMY3-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001268916.1, NM_001281987.1 [Q6ZMY3-2]
NP_001268917.1, NM_001281988.1 [Q6ZMY3-3]
NP_653170.3, NM_144569.5 [Q6ZMY3-1]
XP_011540715.1, XM_011542413.2 [Q6ZMY3-3]
XP_011540716.1, XM_011542414.2 [Q6ZMY3-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000257100; ENSP00000257100; ENSG00000134668 [Q6ZMY3-3]
ENST00000360482; ENSP00000353670; ENSG00000134668 [Q6ZMY3-1]
ENST00000533231; ENSP00000435851; ENSG00000134668 [Q6ZMY3-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
90853

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:90853

UCSC genome browser

More...
UCSCi
uc001bts.3, human [Q6ZMY3-1]

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK058077 mRNA Translation: BAB71652.1 Different initiation.
AK091016 mRNA Translation: BAC03567.1
AK096192 mRNA Translation: BAC04722.1
AK097227 mRNA Translation: BAC04981.1 Different initiation.
AK131447 mRNA Translation: BAD18592.1
AL354919 Genomic DNA No translation available.
BC039870 mRNA Translation: AAH39870.1 Different initiation.
BC114430 mRNA Translation: AAI14431.1
CCDSiCCDS347.1 [Q6ZMY3-1]
CCDS60066.1 [Q6ZMY3-2]
CCDS72748.1 [Q6ZMY3-3]
RefSeqiNP_001268916.1, NM_001281987.1 [Q6ZMY3-2]
NP_001268917.1, NM_001281988.1 [Q6ZMY3-3]
NP_653170.3, NM_144569.5 [Q6ZMY3-1]
XP_011540715.1, XM_011542413.2 [Q6ZMY3-3]
XP_011540716.1, XM_011542414.2 [Q6ZMY3-3]

3D structure databases

SMRiQ6ZMY3
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi124772, 3 interactors
IntActiQ6ZMY3, 2 interactors
STRINGi9606.ENSP00000353670

PTM databases

iPTMnetiQ6ZMY3
PhosphoSitePlusiQ6ZMY3

Polymorphism and mutation databases

BioMutaiSPOCD1
DMDMi74749560

Proteomic databases

jPOSTiQ6ZMY3
MassIVEiQ6ZMY3
PaxDbiQ6ZMY3
PeptideAtlasiQ6ZMY3
PRIDEiQ6ZMY3
ProteomicsDBi67931 [Q6ZMY3-1]
67932 [Q6ZMY3-2]
67933 [Q6ZMY3-3]
67934 [Q6ZMY3-4]
67935 [Q6ZMY3-5]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
31194, 25 antibodies

Genome annotation databases

EnsembliENST00000257100; ENSP00000257100; ENSG00000134668 [Q6ZMY3-3]
ENST00000360482; ENSP00000353670; ENSG00000134668 [Q6ZMY3-1]
ENST00000533231; ENSP00000435851; ENSG00000134668 [Q6ZMY3-2]
GeneIDi90853
KEGGihsa:90853
UCSCiuc001bts.3, human [Q6ZMY3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
90853
DisGeNETi90853
EuPathDBiHostDB:ENSG00000134668.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SPOCD1
HGNCiHGNC:26338, SPOCD1
HPAiENSG00000134668, Tissue enhanced (adipose tissue, urinary bladder)
neXtProtiNX_Q6ZMY3
OpenTargetsiENSG00000134668
PharmGKBiPA134930231

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG1634, Eukaryota
GeneTreeiENSGT00940000162194
HOGENOMiCLU_029996_0_0_1
InParanoidiQ6ZMY3
OMAiESLGGPC
OrthoDBi174961at2759
PhylomeDBiQ6ZMY3
TreeFamiTF350578

Enzyme and pathway databases

PathwayCommonsiQ6ZMY3

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
90853, 6 hits in 843 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SPOCD1, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
90853
PharosiQ6ZMY3, Tdark

Protein Ontology

More...
PROi
PR:Q6ZMY3
RNActiQ6ZMY3, protein

Gene expression databases

BgeeiENSG00000134668, Expressed in stromal cell of endometrium and 146 other tissues
ExpressionAtlasiQ6ZMY3, baseline and differential
GenevisibleiQ6ZMY3, HS

Family and domain databases

Gene3Di1.10.472.30, 1 hit
InterProiView protein in InterPro
IPR012921, SPOC_C
IPR003618, TFIIS_cen_dom
IPR036575, TFIIS_cen_dom_sf
PfamiView protein in Pfam
PF07744, SPOC, 1 hit
PF07500, TFIIS_M, 1 hit
SMARTiView protein in SMART
SM00510, TFS2M, 1 hit
SUPFAMiSSF46942, SSF46942, 1 hit
PROSITEiView protein in PROSITE
PS51321, TFIIS_CENTRAL, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSPOC1_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6ZMY3
Secondary accession number(s): Q24JU3
, Q6PI90, Q8N869, Q8N8U0, Q8NBC6, Q96LN6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: July 5, 2004
Last modified: December 2, 2020
This is version 119 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again