Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 113 (16 Oct 2019)
Sequence version 3 (27 Jul 2011)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Choline transporter-like protein 1

Gene

Slc44a1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Choline transporter. May be involved in membrane synthesis and myelin production.2 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processTransport

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-1483191 Synthesis of PC
R-MMU-425366 Transport of bile salts and organic acids, metal ions and amine compounds
R-MMU-6798163 Choline catabolism

Protein family/group databases

Transport Classification Database

More...
TCDBi
2.A.92.1.1 the choline transporter-like (ctl) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Choline transporter-like protein 1
Alternative name(s):
Solute carrier family 44 member 1
CD_antigen: CD92
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Slc44a1
Synonyms:Cd92, Cdw92, Ctl1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2140592 Slc44a1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini2 – 29CytoplasmicSequence analysisAdd BLAST28
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei30 – 50HelicalSequence analysisAdd BLAST21
Topological domaini51 – 211Mitochondrial intermembraneSequence analysisAdd BLAST161
Transmembranei212 – 232HelicalSequence analysisAdd BLAST21
Topological domaini233 – 237CytoplasmicSequence analysis5
Transmembranei238 – 258HelicalSequence analysisAdd BLAST21
Topological domaini259 – 287Mitochondrial intermembraneSequence analysisAdd BLAST29
Transmembranei288 – 308HelicalSequence analysisAdd BLAST21
Topological domaini309 – 314CytoplasmicSequence analysis6
Transmembranei315 – 335HelicalSequence analysisAdd BLAST21
Topological domaini336 – 337Mitochondrial intermembraneSequence analysis2
Transmembranei338 – 358HelicalSequence analysisAdd BLAST21
Topological domaini359 – 379CytoplasmicSequence analysisAdd BLAST21
Transmembranei380 – 400HelicalSequence analysisAdd BLAST21
Topological domaini401 – 536Mitochondrial intermembraneSequence analysisAdd BLAST136
Transmembranei537 – 557HelicalSequence analysisAdd BLAST21
Topological domaini558 – 565CytoplasmicSequence analysis8
Transmembranei566 – 586HelicalSequence analysisAdd BLAST21
Topological domaini587 – 653Mitochondrial intermembraneSequence analysisAdd BLAST67

Keywords - Cellular componenti

Cell membrane, Membrane, Mitochondrion, Mitochondrion outer membrane

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemoved
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00001917132 – 653Choline transporter-like protein 1Add BLAST652

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi2N-myristoyl glycineBy similarity1

Keywords - PTMi

Lipoprotein, Myristate

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6X893

PRoteomics IDEntifications database

More...
PRIDEi
Q6X893

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
2210

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6X893

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6X893

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q6X893

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Specifically abundant in skeletal muscle (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000028412 Expressed in 298 organ(s), highest expression level in blood

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6X893 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6X893 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000099975

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi473 – 491Cys-richAdd BLAST19

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1362 Eukaryota
ENOG410XS0P LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157174

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231655

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6X893

KEGG Orthology (KO)

More...
KOi
K06515

Identification of Orthologs from Complete Genome Data

More...
OMAi
CLEKCLT

Database of Orthologous Groups

More...
OrthoDBi
329225at2759

TreeFam database of animal gene trees

More...
TreeFami
TF313325

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007603 Choline_transptr-like

The PANTHER Classification System

More...
PANTHERi
PTHR12385 PTHR12385, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04515 Choline_transpo, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6X893-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MGCCSSASAA QSSKREWKPL EDRSCTDIPW LLLFVLFCIG MGFICGFSVA
60 70 80 90 100
TGAAARLVSG YDSYGNICGQ RNAKLEAIPN SGLDHTHRKY VFFLDPCNLD
110 120 130 140 150
LINRKIKSIA LCVAACPRQE LKTLSDVQKF AEINGSALCS YNIKPSEYTL
160 170 180 190 200
TSKSSGFCPK LPVPASAPIP FFHRCAPVNI SCYAKFAEAL ITFVSDNSVL
210 220 230 240 250
HRLISGVMTS KEIILGLCLL SLVLSMILMV IIRYISRVLV WILTVLVILG
260 270 280 290 300
SLGGTGVLWW LYAKQRRSPK EAVIPEQLQI AEDNLRALLI YAISATVFTV
310 320 330 340 350
ILFLIMLVMR KRVALTIALF HVAGKVFIHL PLLVFQPFWT FFALVLFWAY
360 370 380 390 400
WIMTLLFLGT TGSAVQNEQG FVEYKISGPL QYMWWYHVVG LIWISEFILA
410 420 430 440 450
CQQMTVAGAV VTYYFTRDKR NLPFTPILAS VNRLIRYHLG TVAKGSFIIT
460 470 480 490 500
LVKIPRMVLM YIHSQLKGKE NACARCMLKS CICCLWCLEK CLSYLNQNAY
510 520 530 540 550
TATAINSTNF CTSAKDAFVI LVENALRVAA INTVGDFMLF LGKVLIVCST
560 570 580 590 600
GLAGIMLLNY QQDYTVWVLP LIIVCLFAFL VAHCFLSIYE MVVDVLFLCF
610 620 630 640 650
AIDTKYNDGS PGREFYMDKV LMEFVENSRK AMKEAGKGGA ADARELKPML

RKR
Length:653
Mass (Da):73,067
Last modified:July 27, 2011 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i639979730CFE5913
GO
Isoform 2 (identifier: Q6X893-2) [UniParc]FASTAAdd to basket
Also known as: B

The sequence of this isoform differs from the canonical sequence as follows:
     650-653: LRKR → VGSEEEAAALHDFPFHFFSVCVFTDCTSSGEALVVCITQDMLLFLFACLPITWMAEVLSQLRLPSVKVS

Show »
Length:718
Mass (Da):80,094
Checksum:iBE6B6397D3E09F33
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A2AMH5A2AMH5_MOUSE
Choline transporter-like protein 1
Slc44a1
656Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2AMH4A2AMH4_MOUSE
Choline transporter-like protein 1
Slc44a1
718Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2AMH3A2AMH3_MOUSE
Choline transporter-like protein 1
Slc44a1
526Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A2AMH8A2AMH8_MOUSE
Choline transporter-like protein 1
Slc44a1
446Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH25941 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti426P → L in AAP81042 (PubMed:15474312).Curated1
Sequence conflicti426P → L in AAP81043 (PubMed:15474312).Curated1
Sequence conflicti439L → F in AAP81042 (PubMed:15474312).Curated1
Sequence conflicti439L → F in AAP81043 (PubMed:15474312).Curated1
Sequence conflicti510F → L in AAP81042 (PubMed:15474312).Curated1
Sequence conflicti510F → L in AAP81043 (PubMed:15474312).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_015428650 – 653LRKR → VGSEEEAAALHDFPFHFFSV CVFTDCTSSGEALVVCITQD MLLFLFACLPITWMAEVLSQ LRLPSVKVS in isoform 2. 1 Publication4

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY249865 mRNA Translation: AAP81042.1
AY249866 mRNA Translation: AAP81043.1
AL805900 Genomic DNA No translation available.
AL807745 Genomic DNA No translation available.
BC010258 mRNA Translation: AAH10258.1
BC025941 mRNA Translation: AAH25941.1 Different initiation.
BC113167 mRNA Translation: AAI13168.1
BC113169 mRNA Translation: AAI13170.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS18189.1 [Q6X893-1]

NCBI Reference Sequences

More...
RefSeqi
NP_598652.3, NM_133891.3 [Q6X893-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000102911; ENSMUSP00000099975; ENSMUSG00000028412 [Q6X893-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
100434

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:100434

UCSC genome browser

More...
UCSCi
uc008swz.2 mouse [Q6X893-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY249865 mRNA Translation: AAP81042.1
AY249866 mRNA Translation: AAP81043.1
AL805900 Genomic DNA No translation available.
AL807745 Genomic DNA No translation available.
BC010258 mRNA Translation: AAH10258.1
BC025941 mRNA Translation: AAH25941.1 Different initiation.
BC113167 mRNA Translation: AAI13168.1
BC113169 mRNA Translation: AAI13170.1
CCDSiCCDS18189.1 [Q6X893-1]
RefSeqiNP_598652.3, NM_133891.3 [Q6X893-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000099975

Protein family/group databases

TCDBi2.A.92.1.1 the choline transporter-like (ctl) family

PTM databases

GlyConnecti2210
iPTMnetiQ6X893
PhosphoSitePlusiQ6X893
SwissPalmiQ6X893

Proteomic databases

PaxDbiQ6X893
PRIDEiQ6X893

Genome annotation databases

EnsembliENSMUST00000102911; ENSMUSP00000099975; ENSMUSG00000028412 [Q6X893-1]
GeneIDi100434
KEGGimmu:100434
UCSCiuc008swz.2 mouse [Q6X893-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23446
MGIiMGI:2140592 Slc44a1

Phylogenomic databases

eggNOGiKOG1362 Eukaryota
ENOG410XS0P LUCA
GeneTreeiENSGT00940000157174
HOGENOMiHOG000231655
InParanoidiQ6X893
KOiK06515
OMAiCLEKCLT
OrthoDBi329225at2759
TreeFamiTF313325

Enzyme and pathway databases

ReactomeiR-MMU-1483191 Synthesis of PC
R-MMU-425366 Transport of bile salts and organic acids, metal ions and amine compounds
R-MMU-6798163 Choline catabolism

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Slc44a1 mouse

Protein Ontology

More...
PROi
PR:Q6X893

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000028412 Expressed in 298 organ(s), highest expression level in blood
ExpressionAtlasiQ6X893 baseline and differential
GenevisibleiQ6X893 MM

Family and domain databases

InterProiView protein in InterPro
IPR007603 Choline_transptr-like
PANTHERiPTHR12385 PTHR12385, 1 hit
PfamiView protein in Pfam
PF04515 Choline_transpo, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCTL1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6X893
Secondary accession number(s): Q14DK0
, Q6X894, Q8R0Y4, Q91Z29
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 30, 2005
Last sequence update: July 27, 2011
Last modified: October 16, 2019
This is version 113 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again