Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 138 (17 Jun 2020)
Sequence version 2 (16 Aug 2005)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

E3 ubiquitin-protein ligase UBR2

Gene

Ubr2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

E3 ubiquitin-protein ligase which is a component of the N-end rule pathway. Recognizes and binds to proteins bearing specific N-terminal residues that are destabilizing according to the N-end rule, leading to their ubiquitination and subsequent degradation. Plays a critical role in chromatin inactivation and chromosome-wide transcriptional silencing during meiosis via ubiquitination of histone H2A. Binds leucine and is a negative regulator of the leucine-mTOR signaling pathway, thereby controlling cell growth (By similarity). Required for spermatogenesis, promotes, with Tex19.1, SPO11-dependent recombination foci to accumulate and drive robust homologous chromosome synapsis (PubMed:28708824). Polyubiquitinates LINE-1 retrotransposon encoded, LIRE1, which induces degradation, inhibiting LINE-1 retrotransposon mobilization (PubMed:28806172).By similarity4 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

  • S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine. EC:2.3.2.27

<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section describes the metabolic pathway(s) associated with a protein.<p><a href='/help/pathway' target='_top'>More...</a></p>Pathwayi: protein ubiquitination

This protein is involved in the pathway protein ubiquitination, which is part of Protein modification.
View all proteins of this organism that are known to be involved in the pathway protein ubiquitination and in Protein modification.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function%5Fsection">Function</a> section specifies the position(s) and type(s) of zinc fingers within the protein.<p><a href='/help/zn_fing' target='_top'>More...</a></p>Zinc fingeri97 – 168UBR-typePROSITE-ProRule annotationAdd BLAST72
Zinc fingeri1108 – 1214RING-type; atypicalAdd BLAST107

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionTransferase
Biological processUbl conjugation pathway
LigandMetal-binding, Zinc

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-983168 Antigen processing: Ubiquitination & Proteasome degradation

UniPathway: a resource for the exploration and annotation of metabolic pathways

More...
UniPathwayi
UPA00143

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
E3 ubiquitin-protein ligase UBR2 (EC:2.3.2.27)
Alternative name(s):
N-recognin-2
RING-type E3 ubiquitin transferase UBR2
Ubiquitin-protein ligase E3-alpha-2
Ubiquitin-protein ligase E3-alpha-II
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Ubr2
Synonyms:Kiaa0349
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1861099 Ubr2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Male mice are viable but not fertile, due to massive apoptosis of spermatocytes. They have a reduction of testis weight of 68% and no detectable sperm in their epididymis. The seminiferous tubules contain reduced numbers of post-meiotic round, elongated spermatids and accumulation of pyknotic and zygotene-like nuclei. Female mice show severe prenatal lethality, but the rare surviving are fertile. Fibroblast cells display spontaneous chromosome instability and fragility (PubMed:14585983, PubMed:16488448, PubMed:28708824). UBR1 and UBR2 double knockout embryos die at midgestation, with defects in neurogenesis and cardiovascular development. These defects included reduced proliferation as well as precocious migration and differentiation of neural progenitor cells (PubMed:16606826).4 Publications

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section indicates that the initiator methionine is cleaved from the mature protein.<p><a href='/help/init_met' target='_top'>More...</a></p>Initiator methionineiRemovedBy similarity
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000561412 – 1755E3 ubiquitin-protein ligase UBR2Add BLAST1754

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei2N-acetylalanineBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q6WKZ8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6WKZ8

PeptideAtlas

More...
PeptideAtlasi
Q6WKZ8

PRoteomics IDEntifications database

More...
PRIDEi
Q6WKZ8

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6WKZ8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6WKZ8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in skeletal muscle. Also expressed in heart, kidney and testis. Expressed in acinar cells of the pancreas. In testes, expressed primarily in spermatocytes. Expressed in cerebellum (PubMed:28806172).4 Publications

<p>This subsection of the 'Expression' section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

In models of cancer cachexia, induced specifically at the onset and during the progression of muscle wasting.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000023977 Expressed in ear vesicle and 252 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6WKZ8 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6WKZ8 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with UBE2B; promotes the UBE2B-H2A interaction and the ubiquitination of histone H2A by UBE2B and UBR2 (PubMed:14585983, PubMed:20080676).

Interacts with RECQL4 (By similarity).

Interacts with Tex19.1 and Tex19.2; does not lead to Tex19.1 degradation and stabilizes it (PubMed:21103378).

Interacts with L1RE1 (PubMed:28806172).

Interacts with CASP8 (By similarity).

Interacts with ATXN3 (By similarity).

By similarity4 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
230327, 3 interactors

The Eukaryotic Linear Motif resource for Functional Sites in Proteins

More...
ELMi
Q6WKZ8

Protein interaction database and analysis system

More...
IntActi
Q6WKZ8, 1 interactor

Molecular INTeraction database

More...
MINTi
Q6WKZ8

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000108961

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q6WKZ8 protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6WKZ8

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili1019 – 1054Sequence analysisAdd BLAST36

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The RING-H2 zinc finger is an atypical RING finger with a His ligand in place of the fourth Cys of the classical motif.
The UBR-type zinc finger forms a pocket that mediates recognition of type 1 N-degrons. It exhibits preference for Arginine in first position, has poor affinity for histidine, and doesn't bind acetylated peptides (By similarity).By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the UBR1 family.Curated

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri97 – 168UBR-typePROSITE-ProRule annotationAdd BLAST72
Zinc fingeri1108 – 1214RING-type; atypicalAdd BLAST107

Keywords - Domaini

Coiled coil, Zinc-finger

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG1140 Eukaryota
ENOG410XPQU LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00950000183075

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_001801_2_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6WKZ8

KEGG Orthology (KO)

More...
KOi
K10626

Identification of Orthologs from Complete Genome Data

More...
OMAi
PEWECAF

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6WKZ8

TreeFam database of animal gene trees

More...
TreeFami
TF323875

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.10.10.2670, 1 hit
3.30.1390.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003769 ClpS_core
IPR042065 E3_ELL-like
IPR014719 Ribosomal_L7/12_C/ClpS-like
IPR039164 UBR1-like
IPR036390 WH_DNA-bd_sf
IPR003126 Znf_UBR

The PANTHER Classification System

More...
PANTHERi
PTHR21497 PTHR21497, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF02617 ClpS, 1 hit
PF02207 zf-UBR, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00396 ZnF_UBR1, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF46785 SSF46785, 1 hit
SSF54736 SSF54736, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51157 ZF_UBR, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6WKZ8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MASEMEPEVQ AIDRSLLECS AEEIAGRWLQ ATDLNREVYQ HLAHCVPKIY
60 70 80 90 100
CRGPNPFPQK EDTLAQHILL GPMEWYICAE DPALGFPKLE QANKPSHLCG
110 120 130 140 150
RVFKVGEPTY SCRDCAVDPT CVLCMECFLG SIHRDHRYRM TTSGGGGFCD
160 170 180 190 200
CGDTEAWKEG PYCQKHKLSS SEVVEEEDPL VHLSEDVIAR TYNIFAIMFR
210 220 230 240 250
YAVDILTWEK ESELPEDLEV AEKSDTYYCM LFNDEVHTYE QVIYTLQKAV
260 270 280 290 300
NCTQKEAIGF ATTVDRDGRR SVRYGDFQYC DQAKTVIVRN TSRQTKPLKV
310 320 330 340 350
QVMHSSVAAH QNFGLKALSW LGSVIGYSDG LRRILCQVGL QEGPDGENSS
360 370 380 390 400
LVDRLMLNDS KLWKGARSVY HQLFMSSLLM DLKYKKLFAL RFAKNYRQLQ
410 420 430 440 450
RDFMEDDHER AVSVTALSVQ FFTAPTLARM LLTEENLMTV IIKAFMDHLK
460 470 480 490 500
HRDAQGRFQF ERYTALQAFK FRRVQSLILD LKYVLISKPT EWSDELRQKF
510 520 530 540 550
LQGFDAFLEL LKCMQGMDPI TRQVGQHIEM EPEWEAAFTL QMKLTHVISM
560 570 580 590 600
VQDWCALDEK VLIEAYKKCL AVLTQCHGGF TDGEQPITLS ICGHSVETIR
610 620 630 640 650
YCVSQEKVSI HLPISRLLAG LHVLLSKSEV AYKFPELLPL SELSPPMLIE
660 670 680 690 700
HPLRCLVLCA QVHAGMWRRN GFSLVNQIYY YHNVKCRREM FDKDIVMLQT
710 720 730 740 750
GVSMMDPNHF LMIMLSRFEL YQLFSTPDYG KRFSSEVTHK DVVQQNNTLI
760 770 780 790 800
EEMLYLIIML VGERFNPGVG QVAATDEIKR EIIHQLSIKP MAHSELVKSL
810 820 830 840 850
PEDENKETGM ESVIESVAHF KKPGLTGRGM YELKPECAKE FNLYFYHFSR
860 870 880 890 900
AEQSKAEEAQ RKLKRENKED TALPPPALPP FCPLFASLVN ILQCDVMLYI
910 920 930 940 950
MGTILQWAVE HHGSAWSESM LQRVLHLIGM ALQEEKHHLE NAVEGHVQTF
960 970 980 990 1000
TFTQKISKPG DAPHNSPSIL AMLETLQNAP SLEAHKDMIR WLLKMFNAIK
1010 1020 1030 1040 1050
KIRECSSSSP VAEAEGTIME ESSRDKDKAE RKRKAEIARL RREKIMAQMS
1060 1070 1080 1090 1100
EMQRHFIDEN KELFQQTLEL DTSASATLDS SPPVSDAALT ALGPAQTQVP
1110 1120 1130 1140 1150
EPRQFVTCIL CQEEQEVTVG SRAMVLAAFV QRSTVLSKDR TKTIADPEKY
1160 1170 1180 1190 1200
DPLFMHPDLS CGTHTGSCGH VMHAHCWQRY FDSVQAKEQR RQQRLRLHTS
1210 1220 1230 1240 1250
YDVENGEFLC PLCECLSNTV IPLLLPPRSI LSRRLNFSDQ PDLAQWTRAV
1260 1270 1280 1290 1300
TQQIKVVQML RRKHNAADTS SSEDTEAMNI IPIPEGFRPD FYPRNPYSDS
1310 1320 1330 1340 1350
IKEMLTTFGT AAYKVGLKVH PNEGDPRVPI LCWGTCAYTI QSIERILSDE
1360 1370 1380 1390 1400
EKPVFGPLPC RLDDCLRSLT RFAAAHWTVA LLPVVQGHFC KLFASLVPSD
1410 1420 1430 1440 1450
SYEDLPCILD IDMFHLLVGL VLAFPALQCQ DFSGSSLATG DLHIFHLVTM
1460 1470 1480 1490 1500
AHIVQILLTS CTEENGMDQE NPTGEEELAI LSLHKTLHQY TGSALKEAPS
1510 1520 1530 1540 1550
GWHLWRSVRA AIMPFLKCSA LFFHYLNGVP APPDLQVSGT SHFEHLCNYL
1560 1570 1580 1590 1600
SLPTNLIHLF QENSDIMNSL IESWCQNSEV KRYLNGERGA ISYPRGANKL
1610 1620 1630 1640 1650
IDLPEDYSSL INQASNFSCP KSGGDKSRAP TLCLVCGSLL CSQSYCCQAE
1660 1670 1680 1690 1700
LEGEDVGACT AHTYSCGSGA GIFLRVRECQ VLFLAGKTKG CFYSPPYLDD
1710 1720 1730 1740 1750
YGETDQGLRR GNPLHLCQER FRKIQKLWQQ HSITEEIGHA QEANQTLVGI

DWQHL
Length:1,755
Mass (Da):199,155
Last modified:August 16, 2005 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE6D413D674FBBFDA
GO
Isoform 2 (identifier: Q6WKZ8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     397-426: RQLQRDFMEDDHERAVSVTALSVQFFTAPT → ERLQRDYVTDDHDREFSVADLSVQIFTVPS

Show »
Length:1,755
Mass (Da):199,198
Checksum:iF1B0354ED08414B9
GO
Isoform 3 (identifier: Q6WKZ8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-197: Missing.
     397-426: RQLQRDFMEDDHERAVSVTALSVQFFTAPT → ERLQRDYVTDDHDREFSVADLSVQIFTVPS

Show »
Length:1,558
Mass (Da):177,046
Checksum:i6A046013F707B3E0
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A286YCB2A0A286YCB2_MOUSE
E3 ubiquitin-protein ligase
Ubr2
178Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH25617 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated
The sequence AAH31403 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAC65536 differs from that shown. Intron retention.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti59Q → L in AAQ17202 (PubMed:14585983).Curated1
Sequence conflicti137R → Q in AAQ17202 (PubMed:14585983).Curated1
Sequence conflicti137R → Q in BAC65536 (PubMed:12693553).Curated1
Sequence conflicti143S → W in AAQ17202 (PubMed:14585983).Curated1
Sequence conflicti271S → P in AAL32102 (PubMed:15548684).Curated1
Sequence conflicti429 – 435RMLLTEE → PNAPHRKK in AAQ17202 (PubMed:14585983).Curated7
Sequence conflicti656L → P in AAQ17202 (PubMed:14585983).Curated1
Sequence conflicti979A → S in AAQ17202 (PubMed:14585983).Curated1
Sequence conflicti1050S → F in BAC38864 (PubMed:16141072).Curated1
Sequence conflicti1332C → W in AAQ17202 (PubMed:14585983).Curated1
Sequence conflicti1619C → S in AAH26391 (PubMed:15489334).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0151721 – 197Missing in isoform 3. 1 PublicationAdd BLAST197
Alternative sequenceiVSP_015173397 – 426RQLQR…FTAPT → ERLQRDYVTDDHDREFSVAD LSVQIFTVPS in isoform 2 and isoform 3. 2 PublicationsAdd BLAST30

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY280958 mRNA Translation: AAQ17202.1
AY061885 mRNA Translation: AAL32102.1
AK122254 Unassigned DNA Translation: BAC65536.3 Sequence problems.
BC025617 mRNA Translation: AAH25617.1 Different initiation.
BC026391 mRNA Translation: AAH26391.1
BC031403 mRNA Translation: AAH31403.1 Different initiation.
BC075642 mRNA Translation: AAH75642.1
AK083320 mRNA Translation: BAC38864.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS28845.1 [Q6WKZ8-1]
CCDS50127.1 [Q6WKZ8-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001170845.1, NM_001177374.1 [Q6WKZ8-2]
NP_666190.2, NM_146078.3 [Q6WKZ8-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000113335; ENSMUSP00000108961; ENSMUSG00000023977 [Q6WKZ8-2]
ENSMUST00000113337; ENSMUSP00000108963; ENSMUSG00000023977 [Q6WKZ8-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
224826

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:224826

UCSC genome browser

More...
UCSCi
uc012aus.1 mouse [Q6WKZ8-1]
uc012auu.1 mouse [Q6WKZ8-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY280958 mRNA Translation: AAQ17202.1
AY061885 mRNA Translation: AAL32102.1
AK122254 Unassigned DNA Translation: BAC65536.3 Sequence problems.
BC025617 mRNA Translation: AAH25617.1 Different initiation.
BC026391 mRNA Translation: AAH26391.1
BC031403 mRNA Translation: AAH31403.1 Different initiation.
BC075642 mRNA Translation: AAH75642.1
AK083320 mRNA Translation: BAC38864.1
CCDSiCCDS28845.1 [Q6WKZ8-1]
CCDS50127.1 [Q6WKZ8-2]
RefSeqiNP_001170845.1, NM_001177374.1 [Q6WKZ8-2]
NP_666190.2, NM_146078.3 [Q6WKZ8-1]

3D structure databases

SMRiQ6WKZ8
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi230327, 3 interactors
ELMiQ6WKZ8
IntActiQ6WKZ8, 1 interactor
MINTiQ6WKZ8
STRINGi10090.ENSMUSP00000108961

PTM databases

iPTMnetiQ6WKZ8
PhosphoSitePlusiQ6WKZ8

Proteomic databases

EPDiQ6WKZ8
PaxDbiQ6WKZ8
PeptideAtlasiQ6WKZ8
PRIDEiQ6WKZ8

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
30162 203 antibodies

Genome annotation databases

EnsembliENSMUST00000113335; ENSMUSP00000108961; ENSMUSG00000023977 [Q6WKZ8-2]
ENSMUST00000113337; ENSMUSP00000108963; ENSMUSG00000023977 [Q6WKZ8-1]
GeneIDi224826
KEGGimmu:224826
UCSCiuc012aus.1 mouse [Q6WKZ8-1]
uc012auu.1 mouse [Q6WKZ8-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23304
MGIiMGI:1861099 Ubr2

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG1140 Eukaryota
ENOG410XPQU LUCA
GeneTreeiENSGT00950000183075
HOGENOMiCLU_001801_2_0_1
InParanoidiQ6WKZ8
KOiK10626
OMAiPEWECAF
PhylomeDBiQ6WKZ8
TreeFamiTF323875

Enzyme and pathway databases

UniPathwayiUPA00143
ReactomeiR-MMU-983168 Antigen processing: Ubiquitination & Proteasome degradation

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
224826 1 hit in 14 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Ubr2 mouse

Protein Ontology

More...
PROi
PR:Q6WKZ8
RNActiQ6WKZ8 protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000023977 Expressed in ear vesicle and 252 other tissues
ExpressionAtlasiQ6WKZ8 baseline and differential
GenevisibleiQ6WKZ8 MM

Family and domain databases

Gene3Di1.10.10.2670, 1 hit
3.30.1390.10, 1 hit
InterProiView protein in InterPro
IPR003769 ClpS_core
IPR042065 E3_ELL-like
IPR014719 Ribosomal_L7/12_C/ClpS-like
IPR039164 UBR1-like
IPR036390 WH_DNA-bd_sf
IPR003126 Znf_UBR
PANTHERiPTHR21497 PTHR21497, 1 hit
PfamiView protein in Pfam
PF02617 ClpS, 1 hit
PF02207 zf-UBR, 1 hit
SMARTiView protein in SMART
SM00396 ZnF_UBR1, 1 hit
SUPFAMiSSF46785 SSF46785, 1 hit
SSF54736 SSF54736, 1 hit
PROSITEiView protein in PROSITE
PS51157 ZF_UBR, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiUBR2_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6WKZ8
Secondary accession number(s): Q6DIB9
, Q80U31, Q8BUL9, Q8CGW0, Q8K2I6, Q8R0V7, Q8R130
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2005
Last sequence update: August 16, 2005
Last modified: June 17, 2020
This is version 138 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  2. SIMILARITY comments
    Index of protein domains and families
  3. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again