Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q6W5P4 (NPSR1_HUMAN)

Entry version 137 (11 Dec 2019)
Sequence version 1 (05 Jul 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Neuropeptide S receptor

Gene

NPSR1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

G-protein coupled receptor for neuropeptide S (NPS) (PubMed:16790440). Promotes mobilization of intracellular Ca2+ stores (PubMed:16790440). Inhibits cell growth in response to NPS binding (PubMed:15947423). Involved in pathogenesis of asthma and other IgE-mediated diseases.3 Publications

Miscellaneous

Only isoforms with 7 transmembrane topology (isoform 1, isoform 3 and isoform 4) are transported into the plasma membrane in transfected cells, while the truncated ones retain intracellular compartments.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-375276 Peptide ligand-binding receptors
R-HSA-416476 G alpha (q) signalling events
R-HSA-418555 G alpha (s) signalling events

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Neuropeptide S receptor
Alternative name(s):
G-protein coupled receptor 154
G-protein coupled receptor PGR14
G-protein coupled receptor for asthma susceptibility
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NPSR1
Synonyms:GPR154, GPRA, PGR14
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 7

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000187258.13

Human Gene Nomenclature Database

More...HGNCi		HGNC:23631 NPSR1

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		608595 gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q6W5P4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 52ExtracellularSequence analysisAdd BLAST52
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei53 – 73Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini74 – 82CytoplasmicSequence analysis9
Transmembranei83 – 103Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini104 – 123ExtracellularSequence analysisAdd BLAST20
Transmembranei124 – 144Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini145 – 164CytoplasmicSequence analysisAdd BLAST20
Transmembranei165 – 185Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini186 – 212ExtracellularSequence analysisAdd BLAST27
Transmembranei213 – 233Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini234 – 275CytoplasmicSequence analysisAdd BLAST42
Transmembranei276 – 296Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini297 – 312ExtracellularSequence analysisAdd BLAST16
Transmembranei313 – 333Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini334 – 371CytoplasmicSequence analysisAdd BLAST38

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Asthma-related traits 2 (ASRT2)3 Publications
Disease susceptibility is associated with variations affecting the gene represented in this entry.
Disease descriptionAsthma-related traits include clinical symptoms of asthma, such as coughing, wheezing, dyspnea, bronchial hyperresponsiveness as assessed by methacholine challenge test, serum IgE levels, atopy and atopic dermatitis.
Related information in OMIM

Keywords - Diseasei

Asthma

Organism-specific databases

DisGeNET

More...DisGeNETi		387129

MalaCards human disease database

More...MalaCardsi		NPSR1
MIMi608584 phenotype

Open Targets

More...OpenTargetsi		ENSG00000187258

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134951416

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q6W5P4 Tchem

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...ChEMBLi		CHEMBL5162

Drug and drug target database

More...DrugBanki		DB01159 Halothane

IUPHAR/BPS Guide to PHARMACOLOGY

More...GuidetoPHARMACOLOGYi		302

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		NPSR1

Domain mapping of disease mutations (DMDM)

More...DMDMi		74758626

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000696391 – 371Neuropeptide S receptorAdd BLAST371

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi4N-linked (GlcNAc...) asparagineSequence analysis1
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi121 ↔ 197PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q6W5P4

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q6W5P4

PeptideAtlas

More...PeptideAtlasi		Q6W5P4

PRoteomics IDEntifications database

More...PRIDEi		Q6W5P4

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		67745 [Q6W5P4-1]
67746 [Q6W5P4-2]
67747 [Q6W5P4-3]
67748 [Q6W5P4-4]
67749 [Q6W5P4-5]
67750 [Q6W5P4-6]
67751 [Q6W5P4-7]
67752 [Q6W5P4-8]
67753 [Q6W5P4-9]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q6W5P4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q6W5P4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 4 is ubiquitous; it is detected in glandular epithelia of bronchus, stomach, small intestine, colon, uterus, esophagus, spleen, kidney, pancreas, prostate and breast. Isoform 1 is detected in uterus, colon and prostate, and in the smooth muscle cell layer in bronchial and arterial walls (at protein level) (PubMed:15947423). Isoform 1 is predominantly expressed in smooth muscle. Isoform 4 is predominantly expressed in epithelial cells. In bronchial biopsies, it is expressed in smooth muscle cells of asthma patients, but not in control patients; whereas in epithelial cells, its expression is consistently stronger in asthma patients.2 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000187258 Expressed in 13 organ(s), highest expression level in intestine

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q6W5P4 baseline and differential

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

Protein interaction database and analysis system

More...IntActi		Q6W5P4, 16 interactors

Molecular INTeraction database

More...MINTi		Q6W5P4

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000370950

Chemistry databases

BindingDB database of measured binding affinities

More...BindingDBi		Q6W5P4

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q6W5P4 protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the G-protein coupled receptor 1 family. Vasopressin/oxytocin receptor subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3184 Eukaryota
KOG3656 Eukaryota
ENOG410XRW9 LUCA

Ensembl GeneTree

More...GeneTreei		ENSGT00940000155094

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q6W5P4

KEGG Orthology (KO)

More...KOi		K08376

Identification of Orthologs from Complete Genome Data

More...OMAi		IWMKSKA

Database of Orthologous Groups

More...OrthoDBi		1034048at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q6W5P4

TreeFam database of animal gene trees

More...TreeFami		TF106499

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
IPR027294 NPS_rcpt
IPR001817 Vasoprsn_rcpt

The PANTHER Classification System

More...PANTHERi		PTHR24244:SF2 PTHR24244:SF2, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF00001 7tm_1, 1 hit

Protein Motif fingerprint database; a protein domain database

More...PRINTSi		PR00237 GPCRRHODOPSN
PR00896 VASOPRESSINR

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (9)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 9 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q6W5P4-1) [UniParc]FASTAAdd to basket
Also known as: Isoform A

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MPANFTEGSF DSSGTGQTLD SSPVACTETV TFTEVVEGKE WGSFYYSFKT 
        60         70         80         90        100
EQLITLWVLF VFTIVGNSVV LFSTWRRKKK SRMTFFVTQL AITDSFTGLV 
       110        120        130        140        150
NILTDINWRF TGDFTAPDLV CRVVRYLQVV LLYASTYVLV SLSIDRYHAI 
       160        170        180        190        200
VYPMKFLQGE KQARVLIVIA WSLSFLFSIP TLIIFGKRTL SNGEVQCWAL 
       210        220        230        240        250
WPDDSYWTPY MTIVAFLVYF IPLTIISIMY GIVIRTIWIK SKTYETVISN 
       260        270        280        290        300
CSDGKLCSSY NRGLISKAKI KAIKYSIIII LAFICCWSPY FLFDILDNFN 
       310        320        330        340        350
LLPDTQERFY ASVIIQNLPA LNSAINPLIY CVFSSSISFP CREQRSQDSR 
       360        370 
MTFRERTERH EMQILSKPEF I
Length:371
Mass (Da):42,687
Last modified:July 5, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iEA084B381562353D
GO
Isoform 2 (identifier: Q6W5P4-2) [UniParc]FASTAAdd to basket
Also known as: Isoform F

The sequence of this isoform differs from the canonical sequence as follows:
     94-159: Missing.

Show »
Length:305
Mass (Da):35,116
Checksum:i665844DF66FDDC89
GO
Isoform 3 (identifier: Q6W5P4-3) [UniParc]FASTAAdd to basket
Also known as: Isoform G

The sequence of this isoform differs from the canonical sequence as follows:
     343-371: EQRSQDSRMTFRERTERHEMQILSKPEFI → ANSSVYLLAC...GFQNDVPGEN

Show »
Length:390
Mass (Da):44,294
Checksum:i42FACA8D36EBAB1D
GO
Isoform 4 (identifier: Q6W5P4-4) [UniParc]FASTAAdd to basket
Also known as: Isoform B long form

The sequence of this isoform differs from the canonical sequence as follows:
     343-371: EQRSQDSRMTFRERTERHEMQILSKPEFI → VIRLRQLQEAALMLCPQRENWKGTWPGVPSWALPR

Show »
Length:377
Mass (Da):43,123
Checksum:i310B778C70C104B9
GO
Isoform 5 (identifier: Q6W5P4-5) [UniParc]FASTAAdd to basket
Also known as: Isoform B short form

The sequence of this isoform differs from the canonical sequence as follows:
     93-103: Missing.
     343-371: EQRSQDSRMTFRERTERHEMQILSKPEFI → VIRLRQLQEAALMLCPQRENWKGTWPGVPSWALPR

Show »
Length:366
Mass (Da):41,961
Checksum:i523DDC610B719DF0
GO
Isoform 6 (identifier: Q6W5P4-6) [UniParc]FASTAAdd to basket
Also known as: Isoform D

The sequence of this isoform differs from the canonical sequence as follows:
     94-158: DSFTGLVNIL...AIVYPMKFLQ → GCAALRLYLR...HIWEEDTVQR
     159-371: Missing.

Show »
Length:158
Mass (Da):18,043
Checksum:i3D69DADA95C6F873
GO
Isoform 7 (identifier: Q6W5P4-7) [UniParc]FASTAAdd to basket
Also known as: Isoform E

The sequence of this isoform differs from the canonical sequence as follows:
     129-136: VVLLYAST → KSKPGSSL
     137-371: Missing.

Show »
Length:136
Mass (Da):15,327
Checksum:i19AA8C544568D426
GO
Isoform 8 (identifier: Q6W5P4-8) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     130-143: VLLYASTYVLVSLS → MVMKLFHIQKMNME
     144-371: Missing.

Show »
Length:143
Mass (Da):16,403
Checksum:i2F3C09CB873FDFA6
GO
Isoform 9 (identifier: Q6W5P4-9) [UniParc]FASTAAdd to basket
Also known as: Isoform C

The sequence of this isoform differs from the canonical sequence as follows:
     94-94: D → V
     95-371: Missing.

Show »
Length:94
Mass (Da):10,612
Checksum:i324E80DBCA39A3E8
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_023757107N → I Increases cell surface expression and NPS-dependent calcium mobilization; does not affect affinity for NPS.. 5 PublicationsCorresponds to variant dbSNP:rs324981EnsemblClinVar.1
Natural variantiVAR_025103122R → Q1 PublicationCorresponds to variant dbSNP:rs35436513Ensembl.1
Natural variantiVAR_025104143S → G1 PublicationCorresponds to variant dbSNP:rs325465Ensembl.1
Natural variantiVAR_025105197C → F1 PublicationCorresponds to variant dbSNP:rs34705969Ensembl.1
Natural variantiVAR_025106212T → I1 PublicationCorresponds to variant dbSNP:rs35537374Ensembl.1
Natural variantiVAR_023758241S → R1 PublicationCorresponds to variant dbSNP:rs727162Ensembl.1
Natural variantiVAR_025107315I → T1 PublicationCorresponds to variant dbSNP:rs10270766Ensembl.1
Natural variantiVAR_023759344Q → R1 PublicationCorresponds to variant dbSNP:rs6972158Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_01607893 – 103Missing in isoform 5. 1 PublicationAdd BLAST11
Alternative sequenceiVSP_01607994 – 159Missing in isoform 2. 1 PublicationAdd BLAST66
Alternative sequenceiVSP_01608094 – 158DSFTG…MKFLQ → GCAALRLYLRPGVPQHRQIP CHRLPHEVPSRRKASQGPHC DRLEPVFSVLHSHPDHIWEE DTVQR in isoform 6. 1 PublicationAdd BLAST65
Alternative sequenceiVSP_01608194D → V in isoform 9. 1 Publication1
Alternative sequenceiVSP_01608295 – 371Missing in isoform 9. 1 PublicationAdd BLAST277
Alternative sequenceiVSP_016083129 – 136VVLLYAST → KSKPGSSL in isoform 7. 1 Publication8
Alternative sequenceiVSP_016084130 – 143VLLYA…LVSLS → MVMKLFHIQKMNME in isoform 8. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_016085137 – 371Missing in isoform 7. 1 PublicationAdd BLAST235
Alternative sequenceiVSP_016086144 – 371Missing in isoform 8. 1 PublicationAdd BLAST228
Alternative sequenceiVSP_016087159 – 371Missing in isoform 6. 1 PublicationAdd BLAST213
Alternative sequenceiVSP_016088343 – 371EQRSQ…KPEFI → ANSSVYLLACDVSVLWALVL TSEKESCESWRRKGAKITGF QNDVPGEN in isoform 3. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_016089343 – 371EQRSQ…KPEFI → VIRLRQLQEAALMLCPQREN WKGTWPGVPSWALPR in isoform 4 and isoform 5. 3 PublicationsAdd BLAST29

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AY310326 mRNA Translation: AAQ76966.1
AY310327 mRNA Translation: AAQ76967.1
AY310328 mRNA Translation: AAQ76968.1
AY310329 mRNA Translation: AAQ76969.1
AY310330 mRNA Translation: AAQ76970.1
AY310331 mRNA Translation: AAQ76971.1
AY310332 mRNA Translation: AAQ76972.1
AY956446 mRNA Translation: AAX63744.1
AY956447 mRNA Translation: AAX63745.1
AY956448 mRNA Translation: AAX63746.1
AK172847 mRNA Translation: BAD18811.1
DQ272236 Genomic DNA Translation: ABB72550.1
CH471073 Genomic DNA Translation: EAW94036.1
BC132693 mRNA Translation: AAI32694.1
BC132695 mRNA Translation: AAI32696.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS5443.1 [Q6W5P4-4]
CCDS5444.1 [Q6W5P4-1]
CCDS75579.1 [Q6W5P4-3]
CCDS75580.1 [Q6W5P4-5]
CCDS75581.1 [Q6W5P4-2]

NCBI Reference Sequences

More...RefSeqi		NP_001287862.1, NM_001300933.1 [Q6W5P4-5]
NP_001287863.1, NM_001300934.1 [Q6W5P4-2]
NP_001287864.1, NM_001300935.1 [Q6W5P4-3]
NP_997055.1, NM_207172.1 [Q6W5P4-1]
NP_997056.1, NM_207173.1 [Q6W5P4-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000359791; ENSP00000352839; ENSG00000187258 [Q6W5P4-4]
ENST00000360581; ENSP00000353788; ENSG00000187258 [Q6W5P4-1]
ENST00000381539; ENSP00000370950; ENSG00000187258 [Q6W5P4-3]
ENST00000381542; ENSP00000370953; ENSG00000187258 [Q6W5P4-2]
ENST00000381544; ENSP00000370955; ENSG00000187258 [Q6W5P4-6]
ENST00000381553; ENSP00000370965; ENSG00000187258 [Q6W5P4-8]
ENST00000396095; ENSP00000379402; ENSG00000187258 [Q6W5P4-7]
ENST00000465305; ENSP00000434955; ENSG00000187258 [Q6W5P4-9]
ENST00000531252; ENSP00000433258; ENSG00000187258 [Q6W5P4-5]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		387129

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:387129

UCSC genome browser

More...UCSCi		uc003teg.1 human [Q6W5P4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

SeattleSNPs

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY310326 mRNA Translation: AAQ76966.1
AY310327 mRNA Translation: AAQ76967.1
AY310328 mRNA Translation: AAQ76968.1
AY310329 mRNA Translation: AAQ76969.1
AY310330 mRNA Translation: AAQ76970.1
AY310331 mRNA Translation: AAQ76971.1
AY310332 mRNA Translation: AAQ76972.1
AY956446 mRNA Translation: AAX63744.1
AY956447 mRNA Translation: AAX63745.1
AY956448 mRNA Translation: AAX63746.1
AK172847 mRNA Translation: BAD18811.1
DQ272236 Genomic DNA Translation: ABB72550.1
CH471073 Genomic DNA Translation: EAW94036.1
BC132693 mRNA Translation: AAI32694.1
BC132695 mRNA Translation: AAI32696.1
CCDSiCCDS5443.1 [Q6W5P4-4]
CCDS5444.1 [Q6W5P4-1]
CCDS75579.1 [Q6W5P4-3]
CCDS75580.1 [Q6W5P4-5]
CCDS75581.1 [Q6W5P4-2]
RefSeqiNP_001287862.1, NM_001300933.1 [Q6W5P4-5]
NP_001287863.1, NM_001300934.1 [Q6W5P4-2]
NP_001287864.1, NM_001300935.1 [Q6W5P4-3]
NP_997055.1, NM_207172.1 [Q6W5P4-1]
NP_997056.1, NM_207173.1 [Q6W5P4-4]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

IntActiQ6W5P4, 16 interactors
MINTiQ6W5P4
STRINGi9606.ENSP00000370950

Chemistry databases

BindingDBiQ6W5P4
ChEMBLiCHEMBL5162
DrugBankiDB01159 Halothane
GuidetoPHARMACOLOGYi302

Protein family/group databases

Information system for G protein-coupled receptors (GPCRs)

More...GPCRDBi		Search...

PTM databases

iPTMnetiQ6W5P4
PhosphoSitePlusiQ6W5P4

Polymorphism and mutation databases

BioMutaiNPSR1
DMDMi74758626

Proteomic databases

EPDiQ6W5P4
PaxDbiQ6W5P4
PeptideAtlasiQ6W5P4
PRIDEiQ6W5P4
ProteomicsDBi67745 [Q6W5P4-1]
67746 [Q6W5P4-2]
67747 [Q6W5P4-3]
67748 [Q6W5P4-4]
67749 [Q6W5P4-5]
67750 [Q6W5P4-6]
67751 [Q6W5P4-7]
67752 [Q6W5P4-8]
67753 [Q6W5P4-9]

Protocols and materials databases

The DNASU plasmid repository

More...DNASUi		387129

Genome annotation databases

EnsembliENST00000359791; ENSP00000352839; ENSG00000187258 [Q6W5P4-4]
ENST00000360581; ENSP00000353788; ENSG00000187258 [Q6W5P4-1]
ENST00000381539; ENSP00000370950; ENSG00000187258 [Q6W5P4-3]
ENST00000381542; ENSP00000370953; ENSG00000187258 [Q6W5P4-2]
ENST00000381544; ENSP00000370955; ENSG00000187258 [Q6W5P4-6]
ENST00000381553; ENSP00000370965; ENSG00000187258 [Q6W5P4-8]
ENST00000396095; ENSP00000379402; ENSG00000187258 [Q6W5P4-7]
ENST00000465305; ENSP00000434955; ENSG00000187258 [Q6W5P4-9]
ENST00000531252; ENSP00000433258; ENSG00000187258 [Q6W5P4-5]
GeneIDi387129
KEGGihsa:387129
UCSCiuc003teg.1 human [Q6W5P4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		387129
DisGeNETi387129
EuPathDBiHostDB:ENSG00000187258.13

GeneCards: human genes, protein and diseases

More...GeneCardsi		NPSR1
HGNCiHGNC:23631 NPSR1
MalaCardsiNPSR1
MIMi608584 phenotype
608595 gene
neXtProtiNX_Q6W5P4
OpenTargetsiENSG00000187258
PharmGKBiPA134951416

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3184 Eukaryota
KOG3656 Eukaryota
ENOG410XRW9 LUCA
GeneTreeiENSGT00940000155094
InParanoidiQ6W5P4
KOiK08376
OMAiIWMKSKA
OrthoDBi1034048at2759
PhylomeDBiQ6W5P4
TreeFamiTF106499

Enzyme and pathway databases

ReactomeiR-HSA-375276 Peptide ligand-binding receptors
R-HSA-416476 G alpha (q) signalling events
R-HSA-418555 G alpha (s) signalling events

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		NPSR1 human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		Neuropeptide_S_receptor

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		387129
PharosiQ6W5P4 Tchem

Protein Ontology

More...PROi		PR:Q6W5P4
RNActiQ6W5P4 protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000187258 Expressed in 13 organ(s), highest expression level in intestine
ExpressionAtlasiQ6W5P4 baseline and differential

Family and domain databases

InterProiView protein in InterPro
IPR000276 GPCR_Rhodpsn
IPR017452 GPCR_Rhodpsn_7TM
IPR027294 NPS_rcpt
IPR001817 Vasoprsn_rcpt
PANTHERiPTHR24244:SF2 PTHR24244:SF2, 1 hit
PfamiView protein in Pfam
PF00001 7tm_1, 1 hit
PRINTSiPR00237 GPCRRHODOPSN
PR00896 VASOPRESSINR
PROSITEiView protein in PROSITE
PS00237 G_PROTEIN_RECEP_F1_1, 1 hit
PS50262 G_PROTEIN_RECEP_F1_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNPSR1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6W5P4
Secondary accession number(s): A2RTZ4
, Q2XP58, Q56H76, Q56H77, Q56H78, Q6JSL4, Q6JSL5, Q6JSL6, Q6JSL7, Q6JSL8, Q6W5P3, Q6ZMB8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 8, 2005
Last sequence update: July 5, 2004
Last modified: December 11, 2019
This is version 137 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again