Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dead end protein homolog 1

Gene

Dnd1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

RNA-binding factor that positively regulates gene expression by prohibiting miRNA-mediated gene suppression (By similarity). Relieves miRNA repression in germline cells (By similarity). Prohibits the function of several miRNAs by blocking the accessibility of target mRNAs (By similarity). Sequence-specific RNA-binding factor that binds specifically to U-rich regions (URRs) in the 3' untranslated region (3'-UTR) of several mRNAs (By similarity). Does not bind to miRNAs (By similarity). Isoform 1 may play a role during primordial germ cell (PGC) survival. However, does not seem to be essential for PGC migration.By similarity

GO - Molecular functioni

GO - Biological processi

  • germ cell development Source: MGI
  • multicellular organism development Source: UniProtKB-KW
  • negative regulation of gene silencing by miRNA Source: UniProtKB

Keywordsi

Molecular functionDevelopmental protein, RNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Dead end protein homolog 1
Alternative name(s):
RNA-binding motif, single-stranded-interacting protein 4
Gene namesi
Name:Dnd1
Synonyms:Rbms4, Ter
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 18

Organism-specific databases

MGIiMGI:2447763 Dnd1

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Involvement in diseasei

Defects in Dnd1 are the cause of the Ter mutation phenotype. Ter mice are characterized by primordial germ cell loss and susceptibility to spontaneous testicular germ cell tumors (TGCT). They are sterile, but viable. Isoform 1 defects may be the cause of tumor development.1 Publication

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000815691 – 352Dead end protein homolog 1Add BLAST352

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei336Omega-N-methylarginineCombined sources1

Keywords - PTMi

Methylation

Proteomic databases

PaxDbiQ6VY05
PeptideAtlasiQ6VY05
PRIDEiQ6VY05

PTM databases

iPTMnetiQ6VY05
PhosphoSitePlusiQ6VY05

Expressioni

Tissue specificityi

Isoform 1 and isoform 2 are expressed in testis. Isoform 1 is expressed continuously in post natal (PN) testis although levels are low between PN1 to PN6. Isoform 2 is expressed from PN 20 onwards. Isoform 2 is strongly expressed in meiotic and in post-meiotic germ cells of the testis with highest expression at the elongated spermatid stage (at protein level). Expressed in testis and heart. Expressed in germ cells and genital ridges. Not detected in testicular tumors.2 Publications

Developmental stagei

Isoform 1, but not isoform 2, is expressed in embryos at 13.5 and 15.5 dpc. Isoform 1, but not isoform 2, is expressed in primordial gonads at 13.5 and 15.5 dpc. Isoform 1, but not isoform 2, is expressed in ES cell lines. Isoform 1, but not isoform 2, is expressed in embryonic germ (EG) cells (at protein level). Detected in the embryo and allantoic bud at 7.5 dpc, in the neuroectoderm at 8.5 dpc, and widespread at 9.5 dpc, including the neural tube, head mesenchyme, first branchial arch and the hindgut, through which primordial germ cells are migrating. At 11.5 dpc, also expressed in the XY and XX genital ridges. Expressed in genital ridges at 13.5 dpc. Between 12.5 to 14.5 dpc, up-regulated in the testis cords of the XY gonads and down-regulated in XX gonads. Down-regulation occurs progressively as an anterior to posterior wave.3 Publications

Gene expression databases

BgeeiENSMUSG00000044595 Expressed in 90 organ(s), highest expression level in olfactory epithelium
CleanExiMM_DND1
GenevisibleiQ6VY05 MM

Interactioni

Subunit structurei

Interacts with APOBEC3.1 Publication

Protein-protein interaction databases

BioGridi229409, 2 interactors
STRINGi10090.ENSMUSP00000054412

Structurei

3D structure databases

ProteinModelPortaliQ6VY05
SMRiQ6VY05
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini58 – 136RRM 1PROSITE-ProRule annotationAdd BLAST79
Domaini138 – 218RRM 2PROSITE-ProRule annotationAdd BLAST81

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiENOG410IUE0 Eukaryota
ENOG410YAVC LUCA
GeneTreeiENSGT00550000074366
HOGENOMiHOG000112240
HOVERGENiHBG051370
InParanoidiQ6VY05
OMAiMQSKREC
OrthoDBiEOG091G0EUB
PhylomeDBiQ6VY05
TreeFamiTF314932

Family and domain databases

CDDicd12487 RRM1_DND1, 1 hit
Gene3Di3.30.70.330, 2 hits
InterProiView protein in InterPro
IPR034414 DND1_RRM1
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom
PfamiView protein in Pfam
PF00076 RRM_1, 1 hit
SMARTiView protein in SMART
SM00360 RRM, 2 hits
SUPFAMiSSF54928 SSF54928, 1 hit
PROSITEiView protein in PROSITE
PS50102 RRM, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q6VY05-1) [UniParc]FASTAAdd to basket
Also known as: DND1-alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQSKRECEQW CERVNPENKA ALEAWVRETG IRLVQVNGQR KYGGPPPGWV
60 70 80 90 100
GSPPPSGSEV YIGRLPQDVY EHQLIPLFQR VGRLYEFRLM MTFSGLNRGF
110 120 130 140 150
AYARYSSRRG AQAAIATLHN HQLRPSCQLL VCRSTEKCEL TVDGLPLSLN
160 170 180 190 200
RRALLLALQP FGPCLQETLL LPSPGSAPSQ IALLKFSTHR AAAMAKKALV
210 220 230 240 250
EGQSRLCGEQ VAVEWLKPDL KQHFRQQLAG PSLRFLRPDV SQLTQTREKL
260 270 280 290 300
GSQGARAALQ LLCQRMKLGS PVFLTKCLGT GPAGWHRFWY QVVIPGHPVP
310 320 330 340 350
FSGLIWVVLA SDWQDGHEVA KDAVSAQLLE ALSEPRTSLW SPGAEAGTMV

KQ
Length:352
Mass (Da):39,076
Last modified:July 5, 2004 - v1
Checksum:i5503E51D413B7161
GO
Isoform 2 (identifier: Q6VY05-2) [UniParc]FASTAAdd to basket
Also known as: DND1-beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: MQSKRECEQW...VNGQRKYGGP → MVSLPSPPLPPPPSFILELKNILVDHSNQQNPF

Note: May be due to intron retention.
Show »
Length:340
Mass (Da):37,498
Checksum:iEA7EAC6FAB96BE9F
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0129431 – 45MQSKR…KYGGP → MVSLPSPPLPPPPSFILELK NILVDHSNQQNPF in isoform 2. 1 PublicationAdd BLAST45

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY321066 mRNA Translation: AAQ63636.1
BC034897 mRNA Translation: AAH34897.1
CCDSiCCDS29163.2 [Q6VY05-1]
RefSeqiNP_775559.2, NM_173383.2 [Q6VY05-1]
UniGeneiMm.234464

Genome annotation databases

EnsembliENSMUST00000061522; ENSMUSP00000054412; ENSMUSG00000044595 [Q6VY05-1]
GeneIDi213236
KEGGimmu:213236
UCSCiuc008eom.1 mouse [Q6VY05-2]
uc008eon.1 mouse [Q6VY05-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiDND1_MOUSE
AccessioniPrimary (citable) accession number: Q6VY05
Secondary accession number(s): Q8CFK7
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 1, 2005
Last sequence update: July 5, 2004
Last modified: September 12, 2018
This is version 108 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again