Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dead end protein homolog 1

Gene

Dnd1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

RNA-binding factor that positively regulates gene expression by prohibiting miRNA-mediated gene suppression (By similarity). Relieves miRNA repression in germline cells (By similarity). Prohibits the function of several miRNAs by blocking the accessibility of target mRNAs (By similarity). Sequence-specific RNA-binding factor that binds specifically to U-rich regions (URRs) in the 3' untranslated region (3'-UTR) of several mRNAs (By similarity). Does not bind to miRNAs (By similarity). Isoform 1 may play a role during primordial germ cell (PGC) survival. However, does not seem to be essential for PGC migration.By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • AU-rich element binding Source: UniProtKB
  • mRNA binding Source: GO_Central
  • RNA binding Source: GO_Central

GO - Biological processi

  • germ cell development Source: MGI
  • mRNA stabilization Source: GO_Central
  • multicellular organism development Source: UniProtKB-KW
  • negative regulation of gene silencing by miRNA Source: UniProtKB

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, RNA-binding

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Dead end protein homolog 1
Alternative name(s):
RNA-binding motif, single-stranded-interacting protein 4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Dnd1
Synonyms:Rbms4, Ter
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 18

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2447763 Dnd1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Defects in Dnd1 are the cause of the Ter mutation phenotype. Ter mice are characterized by primordial germ cell loss and susceptibility to spontaneous testicular germ cell tumors (TGCT). They are sterile, but viable. Isoform 1 defects may be the cause of tumor development.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000815691 – 352Dead end protein homolog 1Add BLAST352

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei336Omega-N-methylarginineCombined sources1

Keywords - PTMi

Methylation

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6VY05

PeptideAtlas

More...
PeptideAtlasi
Q6VY05

PRoteomics IDEntifications database

More...
PRIDEi
Q6VY05

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6VY05

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6VY05

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Isoform 1 and isoform 2 are expressed in testis. Isoform 1 is expressed continuously in post natal (PN) testis although levels are low between PN1 to PN6. Isoform 2 is expressed from PN 20 onwards. Isoform 2 is strongly expressed in meiotic and in post-meiotic germ cells of the testis with highest expression at the elongated spermatid stage (at protein level). Expressed in testis and heart. Expressed in germ cells and genital ridges. Not detected in testicular tumors.2 Publications

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Isoform 1, but not isoform 2, is expressed in embryos at 13.5 and 15.5 dpc. Isoform 1, but not isoform 2, is expressed in primordial gonads at 13.5 and 15.5 dpc. Isoform 1, but not isoform 2, is expressed in ES cell lines. Isoform 1, but not isoform 2, is expressed in embryonic germ (EG) cells (at protein level). Detected in the embryo and allantoic bud at 7.5 dpc, in the neuroectoderm at 8.5 dpc, and widespread at 9.5 dpc, including the neural tube, head mesenchyme, first branchial arch and the hindgut, through which primordial germ cells are migrating. At 11.5 dpc, also expressed in the XY and XX genital ridges. Expressed in genital ridges at 13.5 dpc. Between 12.5 to 14.5 dpc, up-regulated in the testis cords of the XY gonads and down-regulated in XX gonads. Down-regulation occurs progressively as an anterior to posterior wave.3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000044595 Expressed in 90 organ(s), highest expression level in olfactory epithelium

CleanEx database of gene expression profiles

More...
CleanExi
MM_DND1

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6VY05 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with APOBEC3.1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
229409, 2 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000054412

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q6VY05

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6VY05

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini58 – 136RRM 1PROSITE-ProRule annotationAdd BLAST79
Domaini138 – 218RRM 2PROSITE-ProRule annotationAdd BLAST81

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410IUE0 Eukaryota
ENOG410YAVC LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159225

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000112240

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG051370

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6VY05

Identification of Orthologs from Complete Genome Data

More...
OMAi
RECELWC

Database of Orthologous Groups

More...
OrthoDBi
1384330at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6VY05

TreeFam database of animal gene trees

More...
TreeFami
TF314932

Family and domain databases

Conserved Domains Database

More...
CDDi
cd12487 RRM1_DND1, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.30.70.330, 2 hits

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR034414 DND1_RRM1
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00076 RRM_1, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00360 RRM, 2 hits

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF54928 SSF54928, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50102 RRM, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q6VY05-1) [UniParc]FASTAAdd to basket
Also known as: DND1-alpha

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQSKRECEQW CERVNPENKA ALEAWVRETG IRLVQVNGQR KYGGPPPGWV
60 70 80 90 100
GSPPPSGSEV YIGRLPQDVY EHQLIPLFQR VGRLYEFRLM MTFSGLNRGF
110 120 130 140 150
AYARYSSRRG AQAAIATLHN HQLRPSCQLL VCRSTEKCEL TVDGLPLSLN
160 170 180 190 200
RRALLLALQP FGPCLQETLL LPSPGSAPSQ IALLKFSTHR AAAMAKKALV
210 220 230 240 250
EGQSRLCGEQ VAVEWLKPDL KQHFRQQLAG PSLRFLRPDV SQLTQTREKL
260 270 280 290 300
GSQGARAALQ LLCQRMKLGS PVFLTKCLGT GPAGWHRFWY QVVIPGHPVP
310 320 330 340 350
FSGLIWVVLA SDWQDGHEVA KDAVSAQLLE ALSEPRTSLW SPGAEAGTMV

KQ
Length:352
Mass (Da):39,076
Last modified:July 5, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i5503E51D413B7161
GO
Isoform 2 (identifier: Q6VY05-2) [UniParc]FASTAAdd to basket
Also known as: DND1-beta

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: MQSKRECEQW...VNGQRKYGGP → MVSLPSPPLPPPPSFILELKNILVDHSNQQNPF

Note: May be due to intron retention.
Show »
Length:340
Mass (Da):37,498
Checksum:iEA7EAC6FAB96BE9F
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0129431 – 45MQSKR…KYGGP → MVSLPSPPLPPPPSFILELK NILVDHSNQQNPF in isoform 2. 1 PublicationAdd BLAST45

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY321066 mRNA Translation: AAQ63636.1
BC034897 mRNA Translation: AAH34897.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS29163.2 [Q6VY05-1]

NCBI Reference Sequences

More...
RefSeqi
NP_775559.2, NM_173383.2 [Q6VY05-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.234464

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000061522; ENSMUSP00000054412; ENSMUSG00000044595 [Q6VY05-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
213236

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:213236

UCSC genome browser

More...
UCSCi
uc008eom.1 mouse [Q6VY05-2]
uc008eon.1 mouse [Q6VY05-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY321066 mRNA Translation: AAQ63636.1
BC034897 mRNA Translation: AAH34897.1
CCDSiCCDS29163.2 [Q6VY05-1]
RefSeqiNP_775559.2, NM_173383.2 [Q6VY05-1]
UniGeneiMm.234464

3D structure databases

ProteinModelPortaliQ6VY05
SMRiQ6VY05
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi229409, 2 interactors
STRINGi10090.ENSMUSP00000054412

PTM databases

iPTMnetiQ6VY05
PhosphoSitePlusiQ6VY05

Proteomic databases

PaxDbiQ6VY05
PeptideAtlasiQ6VY05
PRIDEiQ6VY05

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000061522; ENSMUSP00000054412; ENSMUSG00000044595 [Q6VY05-1]
GeneIDi213236
KEGGimmu:213236
UCSCiuc008eom.1 mouse [Q6VY05-2]
uc008eon.1 mouse [Q6VY05-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
373863
MGIiMGI:2447763 Dnd1

Phylogenomic databases

eggNOGiENOG410IUE0 Eukaryota
ENOG410YAVC LUCA
GeneTreeiENSGT00940000159225
HOGENOMiHOG000112240
HOVERGENiHBG051370
InParanoidiQ6VY05
OMAiRECELWC
OrthoDBi1384330at2759
PhylomeDBiQ6VY05
TreeFamiTF314932

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q6VY05

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000044595 Expressed in 90 organ(s), highest expression level in olfactory epithelium
CleanExiMM_DND1
GenevisibleiQ6VY05 MM

Family and domain databases

CDDicd12487 RRM1_DND1, 1 hit
Gene3Di3.30.70.330, 2 hits
InterProiView protein in InterPro
IPR034414 DND1_RRM1
IPR012677 Nucleotide-bd_a/b_plait_sf
IPR035979 RBD_domain_sf
IPR000504 RRM_dom
PfamiView protein in Pfam
PF00076 RRM_1, 1 hit
SMARTiView protein in SMART
SM00360 RRM, 2 hits
SUPFAMiSSF54928 SSF54928, 1 hit
PROSITEiView protein in PROSITE
PS50102 RRM, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiDND1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6VY05
Secondary accession number(s): Q8CFK7
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 1, 2005
Last sequence update: July 5, 2004
Last modified: January 16, 2019
This is version 111 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again