Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q6UXX9 (RSPO2_HUMAN)

Entry version 138 (02 Dec 2020)
Sequence version 2 (15 May 2007)
Previous versions | rss
Add a publicationFeedback
Protein

R-spondin-2

Gene

RSPO2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Activator of the canonical Wnt signaling pathway by acting as a ligand for LGR4-6 receptors. Upon binding to LGR4-6 (LGR4, LGR5 or LGR6), LGR4-6 associate with phosphorylated LRP6 and frizzled receptors that are activated by extracellular Wnt receptors, triggering the canonical Wnt signaling pathway to increase expression of target genes. Also regulates the canonical Wnt/beta-catenin-dependent pathway and non-canonical Wnt signaling by acting as an inhibitor of ZNRF3, an important regulator of the Wnt signaling pathway (PubMed:21909076, PubMed:21727895, PubMed:22615920). During embryonic development, plays a crucial role in limb specification, amplifying the Wnt signaling pathway independently of LGR4-6 receptors, possibly by acting as a direct antagonistic ligand to RNF43 and ZNRF3, hence governing the number of limbs an embryo should form (PubMed:29769720).4 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein, Heparin-binding
Biological processSensory transduction, Wnt signaling pathway

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q6UXX9

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-4641263, Regulation of FZD by ubiquitination

SIGNOR Signaling Network Open Resource

More...SIGNORi		Q6UXX9

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
R-spondin-2
Alternative name(s):
Roof plate-specific spondin-2
Short name:
hRspo2
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:RSPO2
ORF Names:UNQ9384/PRO34209
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000147655.10

Human Gene Nomenclature Database

More...HGNCi		HGNC:28583, RSPO2

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		610575, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q6UXX9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the 'Pathology and Biotech' section provides information on the disease(s) associated with genetic variations in a given protein. The information is extracted from the scientific literature and diseases that are also described in the <a href="http://www.ncbi.nlm.nih.gov/sites/entrez?db=omim">OMIM</a> database are represented with a <a href="http://www.uniprot.org/diseases">controlled vocabulary</a> in the following way:<p><a href='/help/involvement_in_disease' target='_top'>More...</a></p>Involvement in diseasei

Tetraamelia syndrome 2 (TETAMS2)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA form of tetraamelia, a rare disease characterized by rudimentary appendages or complete absence of all four limbs, and other anomalies such as craniofacial, nervous system, pulmonary, skeletal and urogenital defects. TETAMS2 patients manifest limb deformities, bilateral agenesis of the lungs, abnormalities of the pulmonary vasculature, labioscrotal fold aplasia, and dysmorphic features including bilateral cleft lip/palate, ankyloglossia, mandibular hypoplasia, and microretrognathia. TETAMS2 transmission pattern is consistent with autosomal recessive inheritance.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_08103770 – 243Missing in TETAMS2; loss of LGR5-, RNF43- and ZNRF3-binding; complete loss of amplification of WNT3A signaling. 1 PublicationAdd BLAST174
Natural variantiVAR_081038137 – 243Missing in TETAMS2. 1 PublicationAdd BLAST107
Humerofemoral hypoplasia with radiotibial ray deficiency (HHRRD)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA severe disease characterized by reduction of all four limbs as well as hypoplasia of the upper limb girdle and pelvis. Rudimentary finger- or toe-like appendages may be present. HHRRD transmission pattern is consistent with autosomal recessive inheritance.
Related information in OMIM
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_08103669R → C in HHRRD; loss of LGR5-, RNF43- and ZNRF3-binding; decreased ability to amplify WNT3A signaling. 1 PublicationCorresponds to variant dbSNP:rs758888137EnsemblClinVar.1

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology%5Fand%5Fbiotech%5Fsection">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi105F → A: Loss of LGR5-binding, no effect on interaction with RNF43 and ZNRF3, no effect on WNT3A signaling; when associated with A-109. 1 Publication1
Mutagenesisi109F → A: Loss of LGR5-binding, no effect on interaction with RNF43 and ZNRF3, no effect on WNT3A signaling; when associated with A-105. 1 Publication1

Keywords - Diseasei

Disease mutation

Organism-specific databases

DisGeNET

More...DisGeNETi		340419

MalaCards human disease database

More...MalaCardsi		RSPO2
MIMi618021, phenotype
618022, phenotype

Open Targets

More...OpenTargetsi		ENSG00000147655

Orphanet; a database dedicated to information on rare diseases and orphan drugs

More...Orphaneti		3301, Tetraamelia-multiple malformations syndrome

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA142670968

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q6UXX9, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		RSPO2

Domain mapping of disease mutations (DMDM)

More...DMDMi		147744588

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 21Sequence analysisAdd BLAST21
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000023443922 – 243R-spondin-2Add BLAST222

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi40 ↔ 46PROSITE-ProRule annotation
Disulfide bondi43 ↔ 52PROSITE-ProRule annotation
Disulfide bondi55 ↔ 74PROSITE-ProRule annotation
Disulfide bondi78 ↔ 93PROSITE-ProRule annotation
Disulfide bondi96 ↔ 104PROSITE-ProRule annotation
Disulfide bondi101 ↔ 110PROSITE-ProRule annotation
Disulfide bondi113 ↔ 124PROSITE-ProRule annotation
Disulfide bondi128 ↔ 141PROSITE-ProRule annotation
Disulfide bondi145 ↔ 187PROSITE-ProRule annotation
Disulfide bondi156 ↔ 163PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi160N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi196 ↔ 203PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q6UXX9

PeptideAtlas

More...PeptideAtlasi		Q6UXX9

PRoteomics IDEntifications database

More...PRIDEi		Q6UXX9

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		67672 [Q6UXX9-1]
67673 [Q6UXX9-2]
67674 [Q6UXX9-3]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q6UXX9, 1 site

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q6UXX9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000147655, Expressed in lung and 124 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q6UXX9, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q6UXX9, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000147655, Tissue enhanced (brain, placenta)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with WNT1 (By similarity). Binds heparin (By similarity).

Interacts with LGR4, LGR5 and LGR6 (PubMed:21909076, PubMed:21727895, PubMed:22615920, PubMed:29769720).

Interacts with E3 ubiquitin ligases RNF43 and ZNRF3 (PubMed:29769720).

By similarity4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

GO - Molecular functioni

Complete GO annotation on QuickGO ...

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		131049, 20 interactors

Protein interaction database and analysis system

More...IntActi		Q6UXX9, 15 interactors

Molecular INTeraction database

More...MINTi		Q6UXX9

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000276659

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q6UXX9, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q6UXX9

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section indicates the positions and types of repeated sequence motifs or repeated domains within the protein.<p><a href='/help/repeat' target='_top'>More...</a></p>Repeati90 – 134FUAdd BLAST45
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini144 – 204TSP type-1PROSITE-ProRule annotationAdd BLAST61

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The FU repeat is required for activation and stabilization of beta-catenin.By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the R-spondin family.Curated

Keywords - Domaini

Signal

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG3525, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000159194

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_064219_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q6UXX9

Identification of Orthologs from Complete Genome Data

More...OMAi		KQHSIFL

Database of Orthologous Groups

More...OrthoDBi		1441603at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q6UXX9

TreeFam database of animal gene trees

More...TreeFami		TF331799

Family and domain databases

Conserved Domains Database

More...CDDi		cd00064, FU, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.20.100.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR006212, Furin_repeat
IPR009030, Growth_fac_rcpt_cys_sf
IPR042993, RSPO2
IPR043601, Rspo_Fu-CRD_dom
IPR000884, TSP1_rpt
IPR036383, TSP1_rpt_sf

The PANTHER Classification System

More...PANTHERi		PTHR23275:SF79, PTHR23275:SF79, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF15913, Furin-like_2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00261, FU, 2 hits
SM00209, TSP1, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF57184, SSF57184, 1 hit
SSF82895, SSF82895, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50092, TSP1, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6UXX9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQFRLFSFAL IILNCMDYSH CQGNRWRRSK RASYVSNPIC KGCLSCSKDN 
        60         70         80         90        100
GCSRCQQKLF FFLRREGMRQ YGECLHSCPS GYYGHRAPDM NRCARCRIEN 
       110        120        130        140        150
CDSCFSKDFC TKCKVGFYLH RGRCFDECPD GFAPLEETME CVEGCEVGHW 
       160        170        180        190        200
SEWGTCSRNN RTCGFKWGLE TRTRQIVKKP VKDTILCPTI AESRRCKMTM 
       210        220        230        240 
RHCPGGKRTP KAKEKRNKKK KRKLIERAQE QHSVFLATDR ANQ
Length:243
Mass (Da):28,315
Last modified:May 15, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i96F44F105B21BB52
GO
Isoform 2 (identifier: Q6UXX9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: Missing.

Show »
Length:176
Mass (Da):20,426
Checksum:i0F9FD0E1AEE4CA85
GO
Isoform 3 (identifier: Q6UXX9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     32-95: ASYVSNPICKGCLSCSKDNGCSRCQQKLFFFLRREGMRQYGECLHSCPSGYYGHRAPDMNRCAR → G
     143-143: Missing.

Show »
Length:179
Mass (Da):20,972
Checksum:i7C428C4A6C152798
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E5RH25E5RH25_HUMAN
R-spondin-2
RSPO2
121Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RGU9E5RGU9_HUMAN
R-spondin-2
RSPO2
76Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A590UJ52A0A590UJ52_HUMAN
R-spondin-2
RSPO2
38Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_08103669R → C in HHRRD; loss of LGR5-, RNF43- and ZNRF3-binding; decreased ability to amplify WNT3A signaling. 1 PublicationCorresponds to variant dbSNP:rs758888137EnsemblClinVar.1
Natural variantiVAR_08103770 – 243Missing in TETAMS2; loss of LGR5-, RNF43- and ZNRF3-binding; complete loss of amplification of WNT3A signaling. 1 PublicationAdd BLAST174
Natural variantiVAR_081038137 – 243Missing in TETAMS2. 1 PublicationAdd BLAST107
Natural variantiVAR_026247186L → P4 PublicationsCorresponds to variant dbSNP:rs601558Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0183211 – 67Missing in isoform 2. 1 PublicationAdd BLAST67
Alternative sequenceiVSP_01832232 – 95ASYVS…NRCAR → G in isoform 3. 1 PublicationAdd BLAST64
Alternative sequenceiVSP_018323143Missing in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AY358166 mRNA Translation: AAQ88533.1
AK123023 mRNA Translation: BAG53852.1
AC025508 Genomic DNA No translation available.
AP003479 Genomic DNA No translation available.
CH471060 Genomic DNA Translation: EAW91916.1
BC027938 mRNA Translation: AAH27938.1
BC036554 mRNA Translation: AAH36554.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS6307.1 [Q6UXX9-1]
CCDS64953.1 [Q6UXX9-3]
CCDS83314.1 [Q6UXX9-2]

NCBI Reference Sequences

More...RefSeqi		NP_001269792.1, NM_001282863.1 [Q6UXX9-3]
NP_001304871.1, NM_001317942.1 [Q6UXX9-2]
NP_848660.3, NM_178565.4 [Q6UXX9-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000276659; ENSP00000276659; ENSG00000147655 [Q6UXX9-1]
ENST00000517781; ENSP00000427937; ENSG00000147655 [Q6UXX9-3]
ENST00000517939; ENSP00000428940; ENSG00000147655 [Q6UXX9-2]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		340419

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:340419

UCSC genome browser

More...UCSCi		uc003ymq.4, human [Q6UXX9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358166 mRNA Translation: AAQ88533.1
AK123023 mRNA Translation: BAG53852.1
AC025508 Genomic DNA No translation available.
AP003479 Genomic DNA No translation available.
CH471060 Genomic DNA Translation: EAW91916.1
BC027938 mRNA Translation: AAH27938.1
BC036554 mRNA Translation: AAH36554.1
CCDSiCCDS6307.1 [Q6UXX9-1]
CCDS64953.1 [Q6UXX9-3]
CCDS83314.1 [Q6UXX9-2]
RefSeqiNP_001269792.1, NM_001282863.1 [Q6UXX9-3]
NP_001304871.1, NM_001317942.1 [Q6UXX9-2]
NP_848660.3, NM_178565.4 [Q6UXX9-1]

3D structure databases

SMRiQ6UXX9
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi131049, 20 interactors
IntActiQ6UXX9, 15 interactors
MINTiQ6UXX9
STRINGi9606.ENSP00000276659

PTM databases

GlyGeniQ6UXX9, 1 site
PhosphoSitePlusiQ6UXX9

Polymorphism and mutation databases

BioMutaiRSPO2
DMDMi147744588

Proteomic databases

PaxDbiQ6UXX9
PeptideAtlasiQ6UXX9
PRIDEiQ6UXX9
ProteomicsDBi67672 [Q6UXX9-1]
67673 [Q6UXX9-2]
67674 [Q6UXX9-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		26506, 131 antibodies

Genome annotation databases

EnsembliENST00000276659; ENSP00000276659; ENSG00000147655 [Q6UXX9-1]
ENST00000517781; ENSP00000427937; ENSG00000147655 [Q6UXX9-3]
ENST00000517939; ENSP00000428940; ENSG00000147655 [Q6UXX9-2]
GeneIDi340419
KEGGihsa:340419
UCSCiuc003ymq.4, human [Q6UXX9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		340419
DisGeNETi340419
EuPathDBiHostDB:ENSG00000147655.10

GeneCards: human genes, protein and diseases

More...GeneCardsi		RSPO2
HGNCiHGNC:28583, RSPO2
HPAiENSG00000147655, Tissue enhanced (brain, placenta)
MalaCardsiRSPO2
MIMi610575, gene
618021, phenotype
618022, phenotype
neXtProtiNX_Q6UXX9
OpenTargetsiENSG00000147655
Orphaneti3301, Tetraamelia-multiple malformations syndrome
PharmGKBiPA142670968

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG3525, Eukaryota
GeneTreeiENSGT00940000159194
HOGENOMiCLU_064219_1_0_1
InParanoidiQ6UXX9
OMAiKQHSIFL
OrthoDBi1441603at2759
PhylomeDBiQ6UXX9
TreeFamiTF331799

Enzyme and pathway databases

PathwayCommonsiQ6UXX9
ReactomeiR-HSA-4641263, Regulation of FZD by ubiquitination
SIGNORiQ6UXX9

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		340419, 2 hits in 843 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		RSPO2, human

The Gene Wiki collection of pages on human genes and proteins

More...GeneWikii		RSPO2

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		340419
PharosiQ6UXX9, Tbio

Protein Ontology

More...PROi		PR:Q6UXX9
RNActiQ6UXX9, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000147655, Expressed in lung and 124 other tissues
ExpressionAtlasiQ6UXX9, baseline and differential
GenevisibleiQ6UXX9, HS

Family and domain databases

CDDicd00064, FU, 1 hit
Gene3Di2.20.100.10, 1 hit
InterProiView protein in InterPro
IPR006212, Furin_repeat
IPR009030, Growth_fac_rcpt_cys_sf
IPR042993, RSPO2
IPR043601, Rspo_Fu-CRD_dom
IPR000884, TSP1_rpt
IPR036383, TSP1_rpt_sf
PANTHERiPTHR23275:SF79, PTHR23275:SF79, 1 hit
PfamiView protein in Pfam
PF15913, Furin-like_2, 1 hit
SMARTiView protein in SMART
SM00261, FU, 2 hits
SM00209, TSP1, 1 hit
SUPFAMiSSF57184, SSF57184, 1 hit
SSF82895, SSF82895, 1 hit
PROSITEiView protein in PROSITE
PS50092, TSP1, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiRSPO2_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6UXX9
Secondary accession number(s): B3KVP0, Q4G0U4, Q8N6X6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: May 15, 2007
Last modified: December 2, 2020
This is version 138 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again