Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nephronectin

Gene

NPNT

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Functional ligand of integrin alpha-8/beta-1 in kidney development. Regulates the expression of GDNF with integrin alpha-8/beta-1 which is essential for kidney development. May also play a role in the development and function of various tissues, regulating cell adhesion, spreading and survival through the binding of several integrins (By similarity).By similarity

GO - Molecular functioni

  • calcium ion binding Source: InterPro
  • extracellular matrix structural constituent Source: BHF-UCL
  • integrin binding Source: BHF-UCL

GO - Biological processi

Keywordsi

Molecular functionDevelopmental protein
Biological processCell adhesion, Differentiation
LigandCalcium

Enzyme and pathway databases

SIGNORiQ6UXI9

Names & Taxonomyi

Protein namesi
Recommended name:
Nephronectin
Alternative name(s):
Preosteoblast EGF-like repeat protein with MAM domain
Protein EGFL6-like
Gene namesi
Name:NPNT
Synonyms:EGFL6L, POEM
ORF Names:UNQ295/PRO334
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

EuPathDBiHostDB:ENSG00000168743.12
HGNCiHGNC:27405 NPNT
MIMi610306 gene
neXtProtiNX_Q6UXI9

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Extracellular matrix, Secreted

Pathology & Biotechi

Organism-specific databases

DisGeNETi255743
OpenTargetsiENSG00000168743

Polymorphism and mutation databases

BioMutaiNPNT
DMDMi311033424

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 19Sequence analysisAdd BLAST19
ChainiPRO_000029568420 – 565NephronectinAdd BLAST546

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi56 ↔ 69PROSITE-ProRule annotation
Disulfide bondi60 ↔ 75PROSITE-ProRule annotation
Disulfide bondi77 ↔ 86PROSITE-ProRule annotation
Disulfide bondi93 ↔ 104PROSITE-ProRule annotation
Disulfide bondi100 ↔ 113PROSITE-ProRule annotation
Disulfide bondi115 ↔ 127PROSITE-ProRule annotation
Disulfide bondi173 ↔ 186PROSITE-ProRule annotation
Disulfide bondi180 ↔ 195PROSITE-ProRule annotation
Disulfide bondi197 ↔ 212PROSITE-ProRule annotation
Disulfide bondi218 ↔ 231PROSITE-ProRule annotation
Disulfide bondi225 ↔ 240PROSITE-ProRule annotation
Disulfide bondi242 ↔ 253PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond

Proteomic databases

PeptideAtlasiQ6UXI9
PRIDEiQ6UXI9
ProteomicsDBi67631
67632 [Q6UXI9-2]

PTM databases

GlyConnecti1540
iPTMnetiQ6UXI9
PhosphoSitePlusiQ6UXI9

Expressioni

Tissue specificityi

Expressed in kidney and lung and to a lower extent in brain, pregnant uterus, placenta, thyroid gland and blood vessels.1 Publication

Developmental stagei

Expressed in fetal kidney, cochlea, eye, heart and lung.1 Publication

Gene expression databases

BgeeiENSG00000168743 Expressed in 183 organ(s), highest expression level in thyroid gland
CleanExiHS_NPNT
ExpressionAtlasiQ6UXI9 baseline and differential
GenevisibleiQ6UXI9 HS

Organism-specific databases

HPAiHPA003711
HPA050203

Interactioni

Subunit structurei

Homodimer and homotrimer.By similarity

GO - Molecular functioni

Protein-protein interaction databases

BioGridi129117, 1 interactor

Structurei

3D structure databases

ProteinModelPortaliQ6UXI9
SMRiQ6UXI9
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini52 – 87EGF-like 1PROSITE-ProRule annotationAdd BLAST36
Domaini89 – 128EGF-like 2; calcium-bindingPROSITE-ProRule annotationAdd BLAST40
Domaini132 – 168EGF-like 3PROSITE-ProRule annotationAdd BLAST37
Domaini169 – 213EGF-like 4; calcium-bindingPROSITE-ProRule annotationAdd BLAST45
Domaini214 – 254EGF-like 5; calcium-bindingPROSITE-ProRule annotationAdd BLAST41
Domaini420 – 563MAMPROSITE-ProRule annotationAdd BLAST144

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi382 – 384Integrin interaction3

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi296 – 365Pro-richAdd BLAST70

Domaini

The MAM domain is required for localization at the cell surface.By similarity

Sequence similaritiesi

Belongs to the nephronectin family.Curated

Keywords - Domaini

EGF-like domain, Repeat, Signal

Phylogenomic databases

GeneTreeiENSGT00930000150973
HOGENOMiHOG000059638
HOVERGENiHBG108200
InParanoidiQ6UXI9
KOiK06824
PhylomeDBiQ6UXI9
TreeFamiTF330819

Family and domain databases

CDDicd06263 MAM, 1 hit
InterProiView protein in InterPro
IPR013320 ConA-like_dom_sf
IPR001881 EGF-like_Ca-bd_dom
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR018097 EGF_Ca-bd_CS
IPR009030 Growth_fac_rcpt_cys_sf
IPR000998 MAM_dom
PfamiView protein in Pfam
PF07645 EGF_CA, 3 hits
PF00629 MAM, 1 hit
SMARTiView protein in SMART
SM00181 EGF, 5 hits
SM00179 EGF_CA, 3 hits
SM00137 MAM, 1 hit
SUPFAMiSSF49899 SSF49899, 1 hit
SSF57184 SSF57184, 2 hits
PROSITEiView protein in PROSITE
PS00010 ASX_HYDROXYL, 3 hits
PS00022 EGF_1, 1 hit
PS01186 EGF_2, 3 hits
PS50026 EGF_3, 4 hits
PS01187 EGF_CA, 3 hits
PS50060 MAM_2, 1 hit

Sequences (6+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6UXI9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDFLLALVLV SSLYLQAAAE FDGRWPRQIV SSIGLCRYGG RIDCCWGWAR
60 70 80 90 100
QSWGQCQPVC QPRCKHGECI GPNKCKCHPG YAGKTCNQDL NECGLKPRPC
110 120 130 140 150
KHRCMNTYGS YKCYCLNGYM LMPDGSCSSA LTCSMANCQY GCDVVKGQIR
160 170 180 190 200
CQCPSPGLQL APDGRTCVDV DECATGRASC PRFRQCVNTF GSYICKCHKG
210 220 230 240 250
FDLMYIGGKY QCHDIDECSL GQYQCSSFAR CYNIRGSYKC KCKEGYQGDG
260 270 280 290 300
LTCVYIPKVM IEPSGPIHVP KGNGTILKGD TGNNNWIPDV GSTWWPPKTP
310 320 330 340 350
YIPPIITNRP TSKPTTRPTP KPTPIPTPPP PPPLPTELRT PLPPTTPERP
360 370 380 390 400
TTGLTTIAPA ASTPPGGITV DNRVQTDPQK PRGDVFIPRQ PSNDLFEIFE
410 420 430 440 450
IERGVSADDE AKDDPGVLVH SCNFDHGLCG WIREKDNDLH WEPIRDPAGG
460 470 480 490 500
QYLTVSAAKA PGGKAARLVL PLGRLMHSGD LCLSFRHKVT GLHSGTLQVF
510 520 530 540 550
VRKHGAHGAA LWGRNGGHGW RQTQITLRGA DIKSVVFKGE KRRGHTGEIG
560
LDDVSLKKGH CSEER
Length:565
Mass (Da):61,907
Last modified:November 2, 2010 - v3
Checksum:iD4AB4C41B7D5A819
GO
Isoform 2 (identifier: Q6UXI9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     387-416: IPRQPSNDLFEIFEIERGVSADDEAKDDPG → S
     535-564: VVFKGEKRRGHTGEIGLDDVSLKKGHCSEE → ESQ

Note: No experimental confirmation available.
Show »
Length:509
Mass (Da):55,702
Checksum:iE3D7FB3650B7BA29
GO
Isoform 3 (identifier: Q6UXI9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     88-88: Q → QDEHIPAPLDQGSEQPLFQPLDHQATSLPSR

Note: No experimental confirmation available.
Show »
Length:595
Mass (Da):65,213
Checksum:i2A44A7A18BEE77FC
GO
Isoform 4 (identifier: Q6UXI9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     88-88: Q → QDEHIPAPLDQGSEQPLFQPLDHQATSLPSR
     387-416: IPRQPSNDLFEIFEIERGVSADDEAKDDPG → S

Note: No experimental confirmation available.
Show »
Length:566
Mass (Da):61,958
Checksum:iB440DC01AB4FF573
GO
Isoform 5 (identifier: Q6UXI9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     387-416: IPRQPSNDLFEIFEIERGVSADDEAKDDPG → S

Note: No experimental confirmation available.
Show »
Length:536
Mass (Da):58,651
Checksum:i6DC363CBA70A8AA0
GO
Isoform 6 (identifier: Q6UXI9-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     58-58: P → PFYVLRQRIARIRCQLKA

Note: No experimental confirmation available.
Show »
Length:582
Mass (Da):64,023
Checksum:i256AD053250C578A
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RH31D6RH31_HUMAN
Nephronectin
NPNT
609Annotation score:
H0YAK9H0YAK9_HUMAN
Nephronectin
NPNT
453Annotation score:
D6RE63D6RE63_HUMAN
Nephronectin
NPNT
61Annotation score:
H0Y8M1H0Y8M1_HUMAN
Nephronectin
NPNT
104Annotation score:
H0YA60H0YA60_HUMAN
Nephronectin
NPNT
26Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti20E → K in BAG63765 (PubMed:14702039).Curated1
Sequence conflicti340T → A in BAG65139 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_033314159Q → H1 PublicationCorresponds to variant dbSNP:rs35132891Ensembl.1
Natural variantiVAR_033315234I → V3 PublicationsCorresponds to variant dbSNP:rs4340795Ensembl.1
Natural variantiVAR_033316473G → S. Corresponds to variant dbSNP:rs35613262Ensembl.1
Natural variantiVAR_033317476M → T. Corresponds to variant dbSNP:rs35488797Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_04613158P → PFYVLRQRIARIRCQLKA in isoform 6. 1 Publication1
Alternative sequenceiVSP_04581388Q → QDEHIPAPLDQGSEQPLFQP LDHQATSLPSR in isoform 3 and isoform 4. 1 Publication1
Alternative sequenceiVSP_026987387 – 416IPRQP…KDDPG → S in isoform 2, isoform 4 and isoform 5. 2 PublicationsAdd BLAST30
Alternative sequenceiVSP_026988535 – 564VVFKG…HCSEE → ESQ in isoform 2. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358336 mRNA Translation: AAQ88702.1
AK290029 mRNA Translation: BAF82718.1
AK295772 mRNA Translation: BAG58596.1
AK302477 mRNA Translation: BAG63765.1
AK304279 mRNA Translation: BAG65139.1
AK304721 mRNA Translation: BAG65484.1
AC093782 Genomic DNA No translation available.
AC109361 Genomic DNA No translation available.
CH471057 Genomic DNA Translation: EAX06196.1
CCDSiCCDS34046.1 [Q6UXI9-1]
CCDS54784.1 [Q6UXI9-6]
CCDS54785.1 [Q6UXI9-3]
CCDS54786.1 [Q6UXI9-4]
CCDS54787.1 [Q6UXI9-5]
RefSeqiNP_001028219.1, NM_001033047.2 [Q6UXI9-1]
NP_001171619.1, NM_001184690.1 [Q6UXI9-6]
NP_001171620.1, NM_001184691.1 [Q6UXI9-3]
NP_001171621.1, NM_001184692.1 [Q6UXI9-5]
NP_001171622.1, NM_001184693.1 [Q6UXI9-4]
UniGeneiHs.518921

Genome annotation databases

EnsembliENST00000305572; ENSP00000302557; ENSG00000168743 [Q6UXI9-2]
ENST00000379987; ENSP00000369323; ENSG00000168743 [Q6UXI9-1]
ENST00000427316; ENSP00000389252; ENSG00000168743 [Q6UXI9-3]
ENST00000453617; ENSP00000402884; ENSG00000168743 [Q6UXI9-6]
ENST00000506666; ENSP00000422474; ENSG00000168743 [Q6UXI9-4]
ENST00000514622; ENSP00000422044; ENSG00000168743 [Q6UXI9-5]
GeneIDi255743
KEGGihsa:255743
UCSCiuc003hya.4 human [Q6UXI9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358336 mRNA Translation: AAQ88702.1
AK290029 mRNA Translation: BAF82718.1
AK295772 mRNA Translation: BAG58596.1
AK302477 mRNA Translation: BAG63765.1
AK304279 mRNA Translation: BAG65139.1
AK304721 mRNA Translation: BAG65484.1
AC093782 Genomic DNA No translation available.
AC109361 Genomic DNA No translation available.
CH471057 Genomic DNA Translation: EAX06196.1
CCDSiCCDS34046.1 [Q6UXI9-1]
CCDS54784.1 [Q6UXI9-6]
CCDS54785.1 [Q6UXI9-3]
CCDS54786.1 [Q6UXI9-4]
CCDS54787.1 [Q6UXI9-5]
RefSeqiNP_001028219.1, NM_001033047.2 [Q6UXI9-1]
NP_001171619.1, NM_001184690.1 [Q6UXI9-6]
NP_001171620.1, NM_001184691.1 [Q6UXI9-3]
NP_001171621.1, NM_001184692.1 [Q6UXI9-5]
NP_001171622.1, NM_001184693.1 [Q6UXI9-4]
UniGeneiHs.518921

3D structure databases

ProteinModelPortaliQ6UXI9
SMRiQ6UXI9
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi129117, 1 interactor

PTM databases

GlyConnecti1540
iPTMnetiQ6UXI9
PhosphoSitePlusiQ6UXI9

Polymorphism and mutation databases

BioMutaiNPNT
DMDMi311033424

Proteomic databases

PeptideAtlasiQ6UXI9
PRIDEiQ6UXI9
ProteomicsDBi67631
67632 [Q6UXI9-2]

Protocols and materials databases

DNASUi255743
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000305572; ENSP00000302557; ENSG00000168743 [Q6UXI9-2]
ENST00000379987; ENSP00000369323; ENSG00000168743 [Q6UXI9-1]
ENST00000427316; ENSP00000389252; ENSG00000168743 [Q6UXI9-3]
ENST00000453617; ENSP00000402884; ENSG00000168743 [Q6UXI9-6]
ENST00000506666; ENSP00000422474; ENSG00000168743 [Q6UXI9-4]
ENST00000514622; ENSP00000422044; ENSG00000168743 [Q6UXI9-5]
GeneIDi255743
KEGGihsa:255743
UCSCiuc003hya.4 human [Q6UXI9-1]

Organism-specific databases

CTDi255743
DisGeNETi255743
EuPathDBiHostDB:ENSG00000168743.12
GeneCardsiNPNT
H-InvDBiHIX0004424
HGNCiHGNC:27405 NPNT
HPAiHPA003711
HPA050203
MIMi610306 gene
neXtProtiNX_Q6UXI9
OpenTargetsiENSG00000168743
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00930000150973
HOGENOMiHOG000059638
HOVERGENiHBG108200
InParanoidiQ6UXI9
KOiK06824
PhylomeDBiQ6UXI9
TreeFamiTF330819

Enzyme and pathway databases

SIGNORiQ6UXI9

Miscellaneous databases

ChiTaRSiNPNT human
GenomeRNAii255743
PROiPR:Q6UXI9
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000168743 Expressed in 183 organ(s), highest expression level in thyroid gland
CleanExiHS_NPNT
ExpressionAtlasiQ6UXI9 baseline and differential
GenevisibleiQ6UXI9 HS

Family and domain databases

CDDicd06263 MAM, 1 hit
InterProiView protein in InterPro
IPR013320 ConA-like_dom_sf
IPR001881 EGF-like_Ca-bd_dom
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR018097 EGF_Ca-bd_CS
IPR009030 Growth_fac_rcpt_cys_sf
IPR000998 MAM_dom
PfamiView protein in Pfam
PF07645 EGF_CA, 3 hits
PF00629 MAM, 1 hit
SMARTiView protein in SMART
SM00181 EGF, 5 hits
SM00179 EGF_CA, 3 hits
SM00137 MAM, 1 hit
SUPFAMiSSF49899 SSF49899, 1 hit
SSF57184 SSF57184, 2 hits
PROSITEiView protein in PROSITE
PS00010 ASX_HYDROXYL, 3 hits
PS00022 EGF_1, 1 hit
PS01186 EGF_2, 3 hits
PS50026 EGF_3, 4 hits
PS01187 EGF_CA, 3 hits
PS50060 MAM_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiNPNT_HUMAN
AccessioniPrimary (citable) accession number: Q6UXI9
Secondary accession number(s): A6NFT9
, A8K1W4, B4DIT4, B4DYK3, B4E2H7, B4E3H2, D6RCA1, E9PCK8, E9PCQ1, E9PE64, E9PF04
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: November 2, 2010
Last modified: November 7, 2018
This is version 123 of the entry and version 3 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again