Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 129 (31 Jul 2019)
Sequence version 3 (02 Nov 2010)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Nephronectin

Gene

NPNT

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Functional ligand of integrin alpha-8/beta-1 in kidney development. Regulates the expression of GDNF with integrin alpha-8/beta-1 which is essential for kidney development. May also play a role in the development and function of various tissues, regulating cell adhesion, spreading and survival through the binding of several integrins (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • calcium ion binding Source: InterPro
  • integrin binding Source: BHF-UCL

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionDevelopmental protein
Biological processCell adhesion, Differentiation
LigandCalcium

Enzyme and pathway databases

SIGNOR Signaling Network Open Resource

More...
SIGNORi
Q6UXI9

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Nephronectin
Alternative name(s):
Preosteoblast EGF-like repeat protein with MAM domain
Protein EGFL6-like
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:NPNT
Synonyms:EGFL6L, POEM
ORF Names:UNQ295/PRO334
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:27405 NPNT

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610306 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6UXI9

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Extracellular matrix, Secreted

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
255743

Open Targets

More...
OpenTargetsi
ENSG00000168743

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
NPNT

Domain mapping of disease mutations (DMDM)

More...
DMDMi
311033424

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 19Sequence analysisAdd BLAST19
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000029568420 – 565NephronectinAdd BLAST546

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi56 ↔ 69PROSITE-ProRule annotation
Disulfide bondi60 ↔ 75PROSITE-ProRule annotation
Disulfide bondi77 ↔ 86PROSITE-ProRule annotation
Disulfide bondi93 ↔ 104PROSITE-ProRule annotation
Disulfide bondi100 ↔ 113PROSITE-ProRule annotation
Disulfide bondi115 ↔ 127PROSITE-ProRule annotation
Disulfide bondi173 ↔ 186PROSITE-ProRule annotation
Disulfide bondi180 ↔ 195PROSITE-ProRule annotation
Disulfide bondi197 ↔ 212PROSITE-ProRule annotation
Disulfide bondi218 ↔ 231PROSITE-ProRule annotation
Disulfide bondi225 ↔ 240PROSITE-ProRule annotation
Disulfide bondi242 ↔ 253PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6UXI9

PeptideAtlas

More...
PeptideAtlasi
Q6UXI9

PRoteomics IDEntifications database

More...
PRIDEi
Q6UXI9

ProteomicsDB human proteome resource

More...
ProteomicsDBi
19464
19490
19819
19996
67631 [Q6UXI9-1]
67632 [Q6UXI9-2]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1540

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6UXI9

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6UXI9

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in kidney and lung and to a lower extent in brain, pregnant uterus, placenta, thyroid gland and blood vessels.1 Publication

<p>This subsection of the ‘Expression’ section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified ‘at the protein level’.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in fetal kidney, cochlea, eye, heart and lung.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000168743 Expressed in 183 organ(s), highest expression level in thyroid gland

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6UXI9 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6UXI9 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA003711
HPA050203

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Homodimer and homotrimer.

By similarity

GO - Molecular functioni

  • integrin binding Source: BHF-UCL

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
129117, 3 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000389252

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6UXI9

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini52 – 87EGF-like 1PROSITE-ProRule annotationAdd BLAST36
Domaini89 – 128EGF-like 2; calcium-bindingPROSITE-ProRule annotationAdd BLAST40
Domaini132 – 168EGF-like 3PROSITE-ProRule annotationAdd BLAST37
Domaini169 – 213EGF-like 4; calcium-bindingPROSITE-ProRule annotationAdd BLAST45
Domaini214 – 254EGF-like 5; calcium-bindingPROSITE-ProRule annotationAdd BLAST41
Domaini420 – 563MAMPROSITE-ProRule annotationAdd BLAST144

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi382 – 384Integrin interaction3

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi296 – 365Pro-richAdd BLAST70

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The MAM domain is required for localization at the cell surface.By similarity

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the nephronectin family.Curated

Keywords - Domaini

EGF-like domain, Repeat, Signal

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00930000150973

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000059638

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6UXI9

KEGG Orthology (KO)

More...
KOi
K06824

Database of Orthologous Groups

More...
OrthoDBi
766075at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6UXI9

TreeFam database of animal gene trees

More...
TreeFami
TF330819

Family and domain databases

Conserved Domains Database

More...
CDDi
cd06263 MAM, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013320 ConA-like_dom_sf
IPR001881 EGF-like_Ca-bd_dom
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR018097 EGF_Ca-bd_CS
IPR009030 Growth_fac_rcpt_cys_sf
IPR000998 MAM_dom

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07645 EGF_CA, 3 hits
PF00629 MAM, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00181 EGF, 5 hits
SM00179 EGF_CA, 3 hits
SM00137 MAM, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49899 SSF49899, 1 hit
SSF57184 SSF57184, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00010 ASX_HYDROXYL, 3 hits
PS00022 EGF_1, 1 hit
PS01186 EGF_2, 3 hits
PS50026 EGF_3, 4 hits
PS01187 EGF_CA, 3 hits
PS50060 MAM_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (6+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 6 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 6 described isoforms and 5 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6UXI9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDFLLALVLV SSLYLQAAAE FDGRWPRQIV SSIGLCRYGG RIDCCWGWAR
60 70 80 90 100
QSWGQCQPVC QPRCKHGECI GPNKCKCHPG YAGKTCNQDL NECGLKPRPC
110 120 130 140 150
KHRCMNTYGS YKCYCLNGYM LMPDGSCSSA LTCSMANCQY GCDVVKGQIR
160 170 180 190 200
CQCPSPGLQL APDGRTCVDV DECATGRASC PRFRQCVNTF GSYICKCHKG
210 220 230 240 250
FDLMYIGGKY QCHDIDECSL GQYQCSSFAR CYNIRGSYKC KCKEGYQGDG
260 270 280 290 300
LTCVYIPKVM IEPSGPIHVP KGNGTILKGD TGNNNWIPDV GSTWWPPKTP
310 320 330 340 350
YIPPIITNRP TSKPTTRPTP KPTPIPTPPP PPPLPTELRT PLPPTTPERP
360 370 380 390 400
TTGLTTIAPA ASTPPGGITV DNRVQTDPQK PRGDVFIPRQ PSNDLFEIFE
410 420 430 440 450
IERGVSADDE AKDDPGVLVH SCNFDHGLCG WIREKDNDLH WEPIRDPAGG
460 470 480 490 500
QYLTVSAAKA PGGKAARLVL PLGRLMHSGD LCLSFRHKVT GLHSGTLQVF
510 520 530 540 550
VRKHGAHGAA LWGRNGGHGW RQTQITLRGA DIKSVVFKGE KRRGHTGEIG
560
LDDVSLKKGH CSEER
Length:565
Mass (Da):61,907
Last modified:November 2, 2010 - v3
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iD4AB4C41B7D5A819
GO
Isoform 2 (identifier: Q6UXI9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     387-416: IPRQPSNDLFEIFEIERGVSADDEAKDDPG → S
     535-564: VVFKGEKRRGHTGEIGLDDVSLKKGHCSEE → ESQ

Note: No experimental confirmation available.
Show »
Length:509
Mass (Da):55,702
Checksum:iE3D7FB3650B7BA29
GO
Isoform 3 (identifier: Q6UXI9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     88-88: Q → QDEHIPAPLDQGSEQPLFQPLDHQATSLPSR

Note: No experimental confirmation available.
Show »
Length:595
Mass (Da):65,213
Checksum:i2A44A7A18BEE77FC
GO
Isoform 4 (identifier: Q6UXI9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     88-88: Q → QDEHIPAPLDQGSEQPLFQPLDHQATSLPSR
     387-416: IPRQPSNDLFEIFEIERGVSADDEAKDDPG → S

Note: No experimental confirmation available.
Show »
Length:566
Mass (Da):61,958
Checksum:iB440DC01AB4FF573
GO
Isoform 5 (identifier: Q6UXI9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     387-416: IPRQPSNDLFEIFEIERGVSADDEAKDDPG → S

Note: No experimental confirmation available.
Show »
Length:536
Mass (Da):58,651
Checksum:i6DC363CBA70A8AA0
GO
Isoform 6 (identifier: Q6UXI9-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     58-58: P → PFYVLRQRIARIRCQLKA

Note: No experimental confirmation available.
Show »
Length:582
Mass (Da):64,023
Checksum:i256AD053250C578A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
D6RH31D6RH31_HUMAN
Nephronectin
NPNT
609Annotation score:

Annotation score:2 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YAK9H0YAK9_HUMAN
Nephronectin
NPNT
453Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RE63D6RE63_HUMAN
Nephronectin
NPNT
61Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0Y8M1H0Y8M1_HUMAN
Nephronectin
NPNT
104Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YA60H0YA60_HUMAN
Nephronectin
NPNT
26Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti20E → K in BAG63765 (PubMed:14702039).Curated1
Sequence conflicti340T → A in BAG65139 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_033314159Q → H1 PublicationCorresponds to variant dbSNP:rs35132891Ensembl.1
Natural variantiVAR_033315234I → V3 PublicationsCorresponds to variant dbSNP:rs4340795Ensembl.1
Natural variantiVAR_033316473G → S. Corresponds to variant dbSNP:rs35613262Ensembl.1
Natural variantiVAR_033317476M → T. Corresponds to variant dbSNP:rs35488797Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_04613158P → PFYVLRQRIARIRCQLKA in isoform 6. 1 Publication1
Alternative sequenceiVSP_04581388Q → QDEHIPAPLDQGSEQPLFQP LDHQATSLPSR in isoform 3 and isoform 4. 1 Publication1
Alternative sequenceiVSP_026987387 – 416IPRQP…KDDPG → S in isoform 2, isoform 4 and isoform 5. 2 PublicationsAdd BLAST30
Alternative sequenceiVSP_026988535 – 564VVFKG…HCSEE → ESQ in isoform 2. 1 PublicationAdd BLAST30

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY358336 mRNA Translation: AAQ88702.1
AK290029 mRNA Translation: BAF82718.1
AK295772 mRNA Translation: BAG58596.1
AK302477 mRNA Translation: BAG63765.1
AK304279 mRNA Translation: BAG65139.1
AK304721 mRNA Translation: BAG65484.1
AC093782 Genomic DNA No translation available.
AC109361 Genomic DNA No translation available.
CH471057 Genomic DNA Translation: EAX06196.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34046.1 [Q6UXI9-1]
CCDS54784.1 [Q6UXI9-6]
CCDS54785.1 [Q6UXI9-3]
CCDS54786.1 [Q6UXI9-4]
CCDS54787.1 [Q6UXI9-5]

NCBI Reference Sequences

More...
RefSeqi
NP_001028219.1, NM_001033047.2 [Q6UXI9-1]
NP_001171619.1, NM_001184690.1 [Q6UXI9-6]
NP_001171620.1, NM_001184691.1 [Q6UXI9-3]
NP_001171621.1, NM_001184692.1 [Q6UXI9-5]
NP_001171622.1, NM_001184693.1 [Q6UXI9-4]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000305572; ENSP00000302557; ENSG00000168743 [Q6UXI9-2]
ENST00000379987; ENSP00000369323; ENSG00000168743 [Q6UXI9-1]
ENST00000427316; ENSP00000389252; ENSG00000168743 [Q6UXI9-3]
ENST00000453617; ENSP00000402884; ENSG00000168743 [Q6UXI9-6]
ENST00000506666; ENSP00000422474; ENSG00000168743 [Q6UXI9-4]
ENST00000514622; ENSP00000422044; ENSG00000168743 [Q6UXI9-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
255743

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:255743

UCSC genome browser

More...
UCSCi
uc003hya.4 human [Q6UXI9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358336 mRNA Translation: AAQ88702.1
AK290029 mRNA Translation: BAF82718.1
AK295772 mRNA Translation: BAG58596.1
AK302477 mRNA Translation: BAG63765.1
AK304279 mRNA Translation: BAG65139.1
AK304721 mRNA Translation: BAG65484.1
AC093782 Genomic DNA No translation available.
AC109361 Genomic DNA No translation available.
CH471057 Genomic DNA Translation: EAX06196.1
CCDSiCCDS34046.1 [Q6UXI9-1]
CCDS54784.1 [Q6UXI9-6]
CCDS54785.1 [Q6UXI9-3]
CCDS54786.1 [Q6UXI9-4]
CCDS54787.1 [Q6UXI9-5]
RefSeqiNP_001028219.1, NM_001033047.2 [Q6UXI9-1]
NP_001171619.1, NM_001184690.1 [Q6UXI9-6]
NP_001171620.1, NM_001184691.1 [Q6UXI9-3]
NP_001171621.1, NM_001184692.1 [Q6UXI9-5]
NP_001171622.1, NM_001184693.1 [Q6UXI9-4]

3D structure databases

SMRiQ6UXI9
ModBaseiSearch...

Protein-protein interaction databases

BioGridi129117, 3 interactors
STRINGi9606.ENSP00000389252

PTM databases

GlyConnecti1540
iPTMnetiQ6UXI9
PhosphoSitePlusiQ6UXI9

Polymorphism and mutation databases

BioMutaiNPNT
DMDMi311033424

Proteomic databases

jPOSTiQ6UXI9
PeptideAtlasiQ6UXI9
PRIDEiQ6UXI9
ProteomicsDBi19464
19490
19819
19996
67631 [Q6UXI9-1]
67632 [Q6UXI9-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
255743
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000305572; ENSP00000302557; ENSG00000168743 [Q6UXI9-2]
ENST00000379987; ENSP00000369323; ENSG00000168743 [Q6UXI9-1]
ENST00000427316; ENSP00000389252; ENSG00000168743 [Q6UXI9-3]
ENST00000453617; ENSP00000402884; ENSG00000168743 [Q6UXI9-6]
ENST00000506666; ENSP00000422474; ENSG00000168743 [Q6UXI9-4]
ENST00000514622; ENSP00000422044; ENSG00000168743 [Q6UXI9-5]
GeneIDi255743
KEGGihsa:255743
UCSCiuc003hya.4 human [Q6UXI9-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
255743
DisGeNETi255743

GeneCards: human genes, protein and diseases

More...
GeneCardsi
NPNT
HGNCiHGNC:27405 NPNT
HPAiHPA003711
HPA050203
MIMi610306 gene
neXtProtiNX_Q6UXI9
OpenTargetsiENSG00000168743

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00930000150973
HOGENOMiHOG000059638
InParanoidiQ6UXI9
KOiK06824
OrthoDBi766075at2759
PhylomeDBiQ6UXI9
TreeFamiTF330819

Enzyme and pathway databases

SIGNORiQ6UXI9

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
NPNT human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
255743

Protein Ontology

More...
PROi
PR:Q6UXI9

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000168743 Expressed in 183 organ(s), highest expression level in thyroid gland
ExpressionAtlasiQ6UXI9 baseline and differential
GenevisibleiQ6UXI9 HS

Family and domain databases

CDDicd06263 MAM, 1 hit
InterProiView protein in InterPro
IPR013320 ConA-like_dom_sf
IPR001881 EGF-like_Ca-bd_dom
IPR013032 EGF-like_CS
IPR000742 EGF-like_dom
IPR000152 EGF-type_Asp/Asn_hydroxyl_site
IPR018097 EGF_Ca-bd_CS
IPR009030 Growth_fac_rcpt_cys_sf
IPR000998 MAM_dom
PfamiView protein in Pfam
PF07645 EGF_CA, 3 hits
PF00629 MAM, 1 hit
SMARTiView protein in SMART
SM00181 EGF, 5 hits
SM00179 EGF_CA, 3 hits
SM00137 MAM, 1 hit
SUPFAMiSSF49899 SSF49899, 1 hit
SSF57184 SSF57184, 2 hits
PROSITEiView protein in PROSITE
PS00010 ASX_HYDROXYL, 3 hits
PS00022 EGF_1, 1 hit
PS01186 EGF_2, 3 hits
PS50026 EGF_3, 4 hits
PS01187 EGF_CA, 3 hits
PS50060 MAM_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiNPNT_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6UXI9
Secondary accession number(s): A6NFT9
, A8K1W4, B4DIT4, B4DYK3, B4E2H7, B4E3H2, D6RCA1, E9PCK8, E9PCQ1, E9PE64, E9PF04
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 24, 2007
Last sequence update: November 2, 2010
Last modified: July 31, 2019
This is version 129 of the entry and version 3 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again