Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q6UXG3 (CLM9_HUMAN)

Entry version 136 (12 Aug 2020)
Sequence version 2 (18 May 2010)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

CMRF35-like molecule 9

Gene

CD300LG

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Receptor which may mediate L-selectin-dependent lymphocyte rollings. Binds SELL in a calcium dependent manner. Binds lymphocyte (By similarity).By similarity

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor
Biological processImmunity

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q6UXG3

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-198933, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
CMRF35-like molecule 9
Short name:
CLM-9
Alternative name(s):
CD300 antigen-like family member G
Triggering receptor expressed on myeloid cells 4
Short name:
TREM-4
CD_antigen: CD300g
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:CD300LG
Synonyms:CLM9, TREM4
ORF Names:UNQ422/PRO846
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...EuPathDBi		HostDB:ENSG00000161649.12

Human Gene Nomenclature Database

More...HGNCi		HGNC:30455, CD300LG

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		610520, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q6UXG3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini19 – 247ExtracellularSequence analysisAdd BLAST229
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei248 – 268HelicalSequence analysisAdd BLAST21
Topological domaini269 – 332CytoplasmicSequence analysisAdd BLAST64

Keywords - Cellular componenti

Cell membrane, Endosome, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		146894

Open Targets

More...OpenTargetsi		ENSG00000161649

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA142672154

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q6UXG3, Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		CD300LG

Domain mapping of disease mutations (DMDM)

More...DMDMi		296434455

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 181 PublicationAdd BLAST18
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000030611219 – 332CMRF35-like molecule 9Add BLAST314

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the PTM / Processing":/help/ptm_processing_section section describes the positions of cysteine residues participating in disulfide bonds.<p><a href='/help/disulfid' target='_top'>More...</a></p>Disulfide bondi37 ↔ 107PROSITE-ProRule annotation
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi96N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi137O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi143O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi144O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi155O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi161O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi170O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi171O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi177O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi187O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi195O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi196O-linked (GalNAc...) serineSequence analysis1
Glycosylationi199O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi201O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi202O-linked (GalNAc...) serineSequence analysis1
Glycosylationi207O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi208O-linked (GalNAc...) serineSequence analysis1
Glycosylationi213O-linked (GalNAc...) serineSequence analysis1
Glycosylationi214O-linked (GalNAc...) serineSequence analysis1
Glycosylationi222O-linked (GalNAc...) serineSequence analysis1
Glycosylationi223O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi224O-linked (GalNAc...) serineSequence analysis1
Glycosylationi228O-linked (GalNAc...) threonineSequence analysis1
Glycosylationi229O-linked (GalNAc...) serineSequence analysis1
Glycosylationi237O-linked (GalNAc...) serineSequence analysis1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm%5Fprocessing%5Fsection">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

O-glycosylated with sialylated oligosaccharides.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q6UXG3

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q6UXG3

PeptideAtlas

More...PeptideAtlasi		Q6UXG3

PRoteomics IDEntifications database

More...PRIDEi		Q6UXG3

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		27553
30350
67609 [Q6UXG3-1]
67610 [Q6UXG3-2]
67611 [Q6UXG3-3]

PTM databases

GlyGen: Computational and Informatics Resources for Glycoscience

More...GlyGeni		Q6UXG3, 25 sites

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q6UXG3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q6UXG3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in heart, skeletal muscle and placenta.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000161649, Expressed in adipose tissue and 156 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q6UXG3, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q6UXG3, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000161649, Tissue enhanced (adipose tissue, breast)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		127023, 2 interactors

Protein interaction database and analysis system

More...IntActi		Q6UXG3, 6 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000321005

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q6UXG3, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family%5Fand%5Fdomains%5Fsection">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini19 – 121Ig-like V-typeAdd BLAST103

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

Ig-like V-type domain mediates binding to lymphocyte.By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the CD300 family.Curated

Keywords - Domaini

Immunoglobulin domain, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502SURU, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000162429

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_051023_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q6UXG3

KEGG Orthology (KO)

More...KOi		K16663

Identification of Orthologs from Complete Genome Data

More...OMAi		SVHDNPR

Database of Orthologous Groups

More...OrthoDBi		1494510at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q6UXG3

TreeFam database of animal gene trees

More...TreeFami		TF334441

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...Gene3Di		2.60.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR003599, Ig_sub
IPR013106, Ig_V-set

Pfam protein domain database

More...Pfami		View protein in Pfam
PF07686, V-set, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00409, IG, 1 hit

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF48726, SSF48726, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS50835, IG_LIKE, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6UXG3-1) [UniParc]FASTAAdd to basket
Also known as: CD300LG-gamma

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRLLVLLWGC LLLPGYEALE GPEEISGFEG DTVSLQCTYR EELRDHRKYW 
        60         70         80         90        100
CRKGGILFSR CSGTIYAEEE GQETMKGRVS IRDSRQELSL IVTLWNLTLQ 
       110        120        130        140        150
DAGEYWCGVE KRGPDESLLI SLFVFPGPCC PPSPSPTFQP LATTRLQPKA 
       160        170        180        190        200
KAQQTQPPGL TSPGLYPAAT TAKQGKTGAE APPLPGTSQY GHERTSQYTG 
       210        220        230        240        250
TSPHPATSPP AGSSRPPMQL DSTSAEDTSP ALSSGSSKPR VSIPMVRILA 
       260        270        280        290        300
PVLVLLSLLS AAGLIAFCSH LLLWRKEAQQ ATETQRNEKF CLSRLTAEEK 
       310        320        330 
EAPSQAPEGD VISMPPLHTS EEELGFSKFV SA
Length:332
Mass (Da):36,060
Last modified:May 18, 2010 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i2347FF0FA55515FB
GO
Isoform 2 (identifier: Q6UXG3-2) [UniParc]FASTAAdd to basket
Also known as: TREM4-alpha, CD300LG-alpha 1

The sequence of this isoform differs from the canonical sequence as follows:
     127-211: Missing.
     296-332: TAEEKEAPSQAPEGDVISMPPLHTSEEELGFSKFVSA → NHRTSELDPDEAFEISSLTFLSV

Show »
Length:233
Mass (Da):26,091
Checksum:i8D227B31A9739898
GO
Isoform 3 (identifier: Q6UXG3-3) [UniParc]FASTAAdd to basket
Also known as: TREM4-beta, CD300LG-alpha 2

The sequence of this isoform differs from the canonical sequence as follows:
     127-211: Missing.
     296-332: TAEEKEAPSQAPEGDVISMPPLHTSEEELGFSKFVSA → NSLMFSLSLPWL

Show »
Length:222
Mass (Da):24,891
Checksum:i5E3DC88C1EDF86D4
GO
Isoform 4 (identifier: Q6UXG3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     296-332: TAEEKEAPSQAPEGDVISMPPLHTSEEELGFSKFVSA → NSLMFSLSLPWL

Show »
Length:307
Mass (Da):33,521
Checksum:i3E0ED9B3BC4E569D
GO
Isoform 5 (identifier: Q6UXG3-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     127-161: GPCCPPSPSPTFQPLATTRLQPKAKAQQTQPPGLT → A
     296-332: TAEEKEAPSQAPEGDVISMPPLHTSEEELGFSKFVSA → NSLMFSLSLPWL

Show »
Length:273
Mass (Da):29,965
Checksum:i8EBC7C234BADF339
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7EL06K7EL06_HUMAN
CMRF35-like molecule 9
CD300LG
150Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti10C → W in AAN86134 (Ref. 1) Curated1
Sequence conflicti10C → W in AAN86135 (Ref. 1) Curated1
Sequence conflicti45D → G in AAN86134 (Ref. 1) Curated1
Sequence conflicti45D → G in AAN86135 (Ref. 1) Curated1
Sequence conflicti64T → H in AAN86134 (Ref. 1) Curated1
Sequence conflicti64T → H in AAN86135 (Ref. 1) Curated1
Sequence conflicti79V → L in AAN86134 (Ref. 1) Curated1
Sequence conflicti79V → L in AAN86135 (Ref. 1) Curated1
Sequence conflicti113G → A in AAN86134 (Ref. 1) Curated1
Sequence conflicti113G → A in AAN86135 (Ref. 1) Curated1
Sequence conflicti291C → W in AAQ88730 (PubMed:12975309).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_035261221D → N1 PublicationCorresponds to variant dbSNP:rs17852267Ensembl.1
Natural variantiVAR_035262228T → A1 PublicationCorresponds to variant dbSNP:rs12453522Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_028410127 – 211Missing in isoform 2 and isoform 3. 1 PublicationAdd BLAST85
Alternative sequenceiVSP_045362127 – 161GPCCP…PPGLT → A in isoform 5. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_028411296 – 332TAEEK…KFVSA → NHRTSELDPDEAFEISSLTF LSV in isoform 2. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_028412296 – 332TAEEK…KFVSA → NSLMFSLSLPWL in isoform 3, isoform 4 and isoform 5. 2 PublicationsAdd BLAST37

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF427619 mRNA Translation: AAN86134.1
AF427620 mRNA Translation: AAN86135.1
AY358364 mRNA Translation: AAQ88730.1
AK298112 mRNA Translation: BAG60397.1
AK309938 mRNA No translation available.
AC007993 Genomic DNA No translation available.
AC015937 Genomic DNA No translation available.
BC025395 mRNA Translation: AAH25395.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS11470.1 [Q6UXG3-1]
CCDS54131.1 [Q6UXG3-4]
CCDS54132.1 [Q6UXG3-5]
CCDS54133.1 [Q6UXG3-2]

NCBI Reference Sequences

More...RefSeqi		NP_001161794.1, NM_001168322.1 [Q6UXG3-4]
NP_001161795.1, NM_001168323.1 [Q6UXG3-5]
NP_001161796.1, NM_001168324.1 [Q6UXG3-2]
NP_660316.2, NM_145273.3 [Q6UXG3-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000293396; ENSP00000293396; ENSG00000161649 [Q6UXG3-2]
ENST00000317310; ENSP00000321005; ENSG00000161649 [Q6UXG3-1]
ENST00000377203; ENSP00000366408; ENSG00000161649 [Q6UXG3-5]
ENST00000539718; ENSP00000442368; ENSG00000161649 [Q6UXG3-4]
ENST00000586233; ENSP00000468800; ENSG00000161649 [Q6UXG3-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		146894

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:146894

UCSC genome browser

More...UCSCi		uc002iel.3, human [Q6UXG3-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF427619 mRNA Translation: AAN86134.1
AF427620 mRNA Translation: AAN86135.1
AY358364 mRNA Translation: AAQ88730.1
AK298112 mRNA Translation: BAG60397.1
AK309938 mRNA No translation available.
AC007993 Genomic DNA No translation available.
AC015937 Genomic DNA No translation available.
BC025395 mRNA Translation: AAH25395.1
CCDSiCCDS11470.1 [Q6UXG3-1]
CCDS54131.1 [Q6UXG3-4]
CCDS54132.1 [Q6UXG3-5]
CCDS54133.1 [Q6UXG3-2]
RefSeqiNP_001161794.1, NM_001168322.1 [Q6UXG3-4]
NP_001161795.1, NM_001168323.1 [Q6UXG3-5]
NP_001161796.1, NM_001168324.1 [Q6UXG3-2]
NP_660316.2, NM_145273.3 [Q6UXG3-1]

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi127023, 2 interactors
IntActiQ6UXG3, 6 interactors
STRINGi9606.ENSP00000321005

PTM databases

GlyGeniQ6UXG3, 25 sites
iPTMnetiQ6UXG3
PhosphoSitePlusiQ6UXG3

Polymorphism and mutation databases

BioMutaiCD300LG
DMDMi296434455

Proteomic databases

MassIVEiQ6UXG3
PaxDbiQ6UXG3
PeptideAtlasiQ6UXG3
PRIDEiQ6UXG3
ProteomicsDBi27553
30350
67609 [Q6UXG3-1]
67610 [Q6UXG3-2]
67611 [Q6UXG3-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		1022, 85 antibodies

The DNASU plasmid repository

More...DNASUi		146894

Genome annotation databases

EnsembliENST00000293396; ENSP00000293396; ENSG00000161649 [Q6UXG3-2]
ENST00000317310; ENSP00000321005; ENSG00000161649 [Q6UXG3-1]
ENST00000377203; ENSP00000366408; ENSG00000161649 [Q6UXG3-5]
ENST00000539718; ENSP00000442368; ENSG00000161649 [Q6UXG3-4]
ENST00000586233; ENSP00000468800; ENSG00000161649 [Q6UXG3-3]
GeneIDi146894
KEGGihsa:146894
UCSCiuc002iel.3, human [Q6UXG3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		146894
DisGeNETi146894
EuPathDBiHostDB:ENSG00000161649.12

GeneCards: human genes, protein and diseases

More...GeneCardsi		CD300LG
HGNCiHGNC:30455, CD300LG
HPAiENSG00000161649, Tissue enhanced (adipose tissue, breast)
MIMi610520, gene
neXtProtiNX_Q6UXG3
OpenTargetsiENSG00000161649
PharmGKBiPA142672154

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502SURU, Eukaryota
GeneTreeiENSGT00940000162429
HOGENOMiCLU_051023_1_0_1
InParanoidiQ6UXG3
KOiK16663
OMAiSVHDNPR
OrthoDBi1494510at2759
PhylomeDBiQ6UXG3
TreeFamiTF334441

Enzyme and pathway databases

PathwayCommonsiQ6UXG3
ReactomeiR-HSA-198933, Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		146894, 6 hits in 870 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		146894
PharosiQ6UXG3, Tdark

Protein Ontology

More...PROi		PR:Q6UXG3
RNActiQ6UXG3, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000161649, Expressed in adipose tissue and 156 other tissues
ExpressionAtlasiQ6UXG3, baseline and differential
GenevisibleiQ6UXG3, HS

Family and domain databases

Gene3Di2.60.40.10, 1 hit
InterProiView protein in InterPro
IPR007110, Ig-like_dom
IPR036179, Ig-like_dom_sf
IPR013783, Ig-like_fold
IPR003599, Ig_sub
IPR013106, Ig_V-set
PfamiView protein in Pfam
PF07686, V-set, 1 hit
SMARTiView protein in SMART
SM00409, IG, 1 hit
SUPFAMiSSF48726, SSF48726, 1 hit
PROSITEiView protein in PROSITE
PS50835, IG_LIKE, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCLM9_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6UXG3
Secondary accession number(s): B4DNY5
, F5H7P9, F8W9M3, Q8IX38, Q8IX39, Q8TA95
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: October 2, 2007
Last sequence update: May 18, 2010
Last modified: August 12, 2020
This is version 136 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families
  6. Human cell differentiation molecules
    CD nomenclature of surface proteins of human leucocytes and list of entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again