Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Layilin

Gene

LAYN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Receptor for hyaluronate.1 Publication

GO - Molecular functioni

  • carbohydrate binding Source: UniProtKB-KW
  • hyaluronic acid binding Source: HGNC

Keywordsi

LigandLectin

Names & Taxonomyi

Protein namesi
Recommended name:
Layilin
Gene namesi
Name:LAYN
ORF Names:UNQ208/PRO234
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000204381.11
HGNCiHGNC:29471 LAYN
neXtProtiNX_Q6UX15

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini22 – 235ExtracellularSequence analysisAdd BLAST214
Transmembranei236 – 256HelicalSequence analysisAdd BLAST21
Topological domaini257 – 382CytoplasmicSequence analysisAdd BLAST126

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi143903
OpenTargetsiENSG00000204381
PharmGKBiPA142671570

Chemistry databases

DrugBankiDB08818 Hyaluronic acid

Polymorphism and mutation databases

BioMutaiLAYN

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 21Sequence analysisAdd BLAST21
ChainiPRO_000026250822 – 382LayilinAdd BLAST361

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi71 ↔ 184PROSITE-ProRule annotation
Glycosylationi117N-linked (GlcNAc...) asparagineSequence analysis1
Disulfide bondi150 ↔ 176PROSITE-ProRule annotation
Modified residuei286PhosphoserineBy similarity1
Modified residuei299PhosphoserineBy similarity1

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

EPDiQ6UX15
MaxQBiQ6UX15
PaxDbiQ6UX15
PeptideAtlasiQ6UX15
PRIDEiQ6UX15
ProteomicsDBi67550
67551 [Q6UX15-2]

PTM databases

iPTMnetiQ6UX15
PhosphoSitePlusiQ6UX15
SwissPalmiQ6UX15

Expressioni

Gene expression databases

BgeeiENSG00000204381 Expressed in 176 organ(s), highest expression level in decidua
CleanExiHS_LAYN
ExpressionAtlasiQ6UX15 baseline and differential
GenevisibleiQ6UX15 HS

Organism-specific databases

HPAiHPA040087

Interactioni

Subunit structurei

Interacts with NF2, RDX and TLN1.By similarity

Protein-protein interaction databases

BioGridi126823, 1 interactor
IntActiQ6UX15, 4 interactors
MINTiQ6UX15
STRINGi9606.ENSP00000364764

Structurei

3D structure databases

ProteinModelPortaliQ6UX15
SMRiQ6UX15
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini45 – 185C-type lectinPROSITE-ProRule annotationAdd BLAST141
Repeati340 – 3441-15
Repeati350 – 3541-25
Repeati356 – 3592-14
Repeati371 – 3751-35
Repeati377 – 3802-24

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni330 – 374Interaction with NF2By similarityAdd BLAST45
Regioni337 – 382Interaction with TLN1By similarityAdd BLAST46
Regioni340 – 3753 X 5 AA repeats of E-S-G-X-VAdd BLAST36
Regioni356 – 3802 X 4 AA repeats of N-X-I-YAdd BLAST25

Domaini

The C-terminal domain interacts with the N-terminal domain of RDX.By similarity

Keywords - Domaini

Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IS3Y Eukaryota
ENOG410XR2Y LUCA
GeneTreeiENSGT00390000001844
HOGENOMiHOG000069977
HOVERGENiHBG050945
InParanoidiQ6UX15
KOiK10077
OMAiGTQKPCY
OrthoDBiEOG091G0FDX
PhylomeDBiQ6UX15
TreeFamiTF330715

Family and domain databases

Gene3Di3.10.100.10, 1 hit
InterProiView protein in InterPro
IPR001304 C-type_lectin-like
IPR016186 C-type_lectin-like/link_sf
IPR016187 CTDL_fold
PfamiView protein in Pfam
PF00059 Lectin_C, 1 hit
SMARTiView protein in SMART
SM00034 CLECT, 1 hit
SUPFAMiSSF56436 SSF56436, 1 hit
PROSITEiView protein in PROSITE
PS50041 C_TYPE_LECTIN_2, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6UX15-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRPGTALQAV LLAVLLVGLR AATGRLLSAS DLDLRGGQPV CRGGTQRPCY
60 70 80 90 100
KVIYFHDTSR RLNFEEAKEA CRRDGGQLVS IESEDEQKLI EKFIENLLPS
110 120 130 140 150
DGDFWIGLRR REEKQSNSTA CQDLYAWTDG SISQFRNWYV DEPSCGSEVC
160 170 180 190 200
VVMYHQPSAP AGIGGPYMFQ WNDDRCNMKN NFICKYSDEK PAVPSREAEG
210 220 230 240 250
EETELTTPVL PEETQEEDAK KTFKESREAA LNLAYILIPS IPLLLLLVVT
260 270 280 290 300
TVVCWVWICR KRKREQPDPS TKKQHTIWPS PHQGNSPDLE VYNVIRKQSE
310 320 330 340 350
ADLAETRPDL KNISFRVCSG EATPDDMSCD YDNMAVNPSE SGFVTLVSVE
360 370 380
SGFVTNDIYE FSPDQMGRSK ESGWVENEIY GY
Length:382
Mass (Da):43,108
Last modified:July 5, 2004 - v1
Checksum:i5843084E56E11325
GO
Isoform 2 (identifier: Q6UX15-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     29-36: Missing.

Show »
Length:374
Mass (Da):42,281
Checksum:i8AE64E6BC9E56DCD
GO
Isoform 3 (identifier: Q6UX15-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-35: MRPGTALQAVLLAVLLVGLRAATGRLLSASDLDLR → MVTSGLGSGGVRRNKAIAQPARTFMLGLMAAYHNL
     36-188: Missing.

Note: No experimental confirmation available.
Show »
Length:229
Mass (Da):25,571
Checksum:i0EE863791994B444
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9PQU7E9PQU7_HUMAN
Layilin
LAYN
270Annotation score:
E9PMI0E9PMI0_HUMAN
Layilin
LAYN
262Annotation score:
E9PK64E9PK64_HUMAN
Layilin
LAYN
109Annotation score:
A0A0D9SFG0A0A0D9SFG0_HUMAN
Layilin
LAYN
108Annotation score:
E9PR90E9PR90_HUMAN
Layilin
LAYN
134Annotation score:
E9PQY8E9PQY8_HUMAN
Layilin
LAYN
49Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti219A → T in BAB70978 (PubMed:14702039).Curated1
Sequence conflicti344V → M in AAH25407 (PubMed:15489334).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_02949666E → K. Corresponds to variant dbSNP:rs11827718Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0546601 – 35MRPGT…DLDLR → MVTSGLGSGGVRRNKAIAQP ARTFMLGLMAAYHNL in isoform 3. 1 PublicationAdd BLAST35
Alternative sequenceiVSP_02178129 – 36Missing in isoform 2. 2 Publications8
Alternative sequenceiVSP_05466136 – 188Missing in isoform 3. 1 PublicationAdd BLAST153

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358554 mRNA Translation: AAQ88918.1
AK055539 mRNA Translation: BAB70946.1
AK055654 mRNA Translation: BAB70978.1
AK296231 mRNA Translation: BAG58952.1
AP002008 Genomic DNA No translation available.
CH471065 Genomic DNA Translation: EAW67145.1
BC025407 mRNA Translation: AAH25407.1
CCDSiCCDS31676.1 [Q6UX15-2]
CCDS58178.1 [Q6UX15-1]
CCDS58179.1 [Q6UX15-3]
RefSeqiNP_001245319.1, NM_001258390.1 [Q6UX15-1]
NP_001245320.1, NM_001258391.1 [Q6UX15-3]
NP_001305728.1, NM_001318799.1
NP_849156.1, NM_178834.4 [Q6UX15-2]
XP_006718833.1, XM_006718770.3 [Q6UX15-3]
UniGeneiHs.503831

Genome annotation databases

EnsembliENST00000375614; ENSP00000364764; ENSG00000204381 [Q6UX15-2]
ENST00000375615; ENSP00000364765; ENSG00000204381 [Q6UX15-1]
ENST00000436913; ENSP00000392942; ENSG00000204381 [Q6UX15-3]
GeneIDi143903
KEGGihsa:143903
UCSCiuc001plp.3 human [Q6UX15-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358554 mRNA Translation: AAQ88918.1
AK055539 mRNA Translation: BAB70946.1
AK055654 mRNA Translation: BAB70978.1
AK296231 mRNA Translation: BAG58952.1
AP002008 Genomic DNA No translation available.
CH471065 Genomic DNA Translation: EAW67145.1
BC025407 mRNA Translation: AAH25407.1
CCDSiCCDS31676.1 [Q6UX15-2]
CCDS58178.1 [Q6UX15-1]
CCDS58179.1 [Q6UX15-3]
RefSeqiNP_001245319.1, NM_001258390.1 [Q6UX15-1]
NP_001245320.1, NM_001258391.1 [Q6UX15-3]
NP_001305728.1, NM_001318799.1
NP_849156.1, NM_178834.4 [Q6UX15-2]
XP_006718833.1, XM_006718770.3 [Q6UX15-3]
UniGeneiHs.503831

3D structure databases

ProteinModelPortaliQ6UX15
SMRiQ6UX15
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi126823, 1 interactor
IntActiQ6UX15, 4 interactors
MINTiQ6UX15
STRINGi9606.ENSP00000364764

Chemistry databases

DrugBankiDB08818 Hyaluronic acid

PTM databases

iPTMnetiQ6UX15
PhosphoSitePlusiQ6UX15
SwissPalmiQ6UX15

Polymorphism and mutation databases

BioMutaiLAYN

Proteomic databases

EPDiQ6UX15
MaxQBiQ6UX15
PaxDbiQ6UX15
PeptideAtlasiQ6UX15
PRIDEiQ6UX15
ProteomicsDBi67550
67551 [Q6UX15-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000375614; ENSP00000364764; ENSG00000204381 [Q6UX15-2]
ENST00000375615; ENSP00000364765; ENSG00000204381 [Q6UX15-1]
ENST00000436913; ENSP00000392942; ENSG00000204381 [Q6UX15-3]
GeneIDi143903
KEGGihsa:143903
UCSCiuc001plp.3 human [Q6UX15-1]

Organism-specific databases

CTDi143903
DisGeNETi143903
EuPathDBiHostDB:ENSG00000204381.11
GeneCardsiLAYN
H-InvDBiHIX0010105
HGNCiHGNC:29471 LAYN
HPAiHPA040087
neXtProtiNX_Q6UX15
OpenTargetsiENSG00000204381
PharmGKBiPA142671570
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IS3Y Eukaryota
ENOG410XR2Y LUCA
GeneTreeiENSGT00390000001844
HOGENOMiHOG000069977
HOVERGENiHBG050945
InParanoidiQ6UX15
KOiK10077
OMAiGTQKPCY
OrthoDBiEOG091G0FDX
PhylomeDBiQ6UX15
TreeFamiTF330715

Miscellaneous databases

GenomeRNAii143903
PROiPR:Q6UX15

Gene expression databases

BgeeiENSG00000204381 Expressed in 176 organ(s), highest expression level in decidua
CleanExiHS_LAYN
ExpressionAtlasiQ6UX15 baseline and differential
GenevisibleiQ6UX15 HS

Family and domain databases

Gene3Di3.10.100.10, 1 hit
InterProiView protein in InterPro
IPR001304 C-type_lectin-like
IPR016186 C-type_lectin-like/link_sf
IPR016187 CTDL_fold
PfamiView protein in Pfam
PF00059 Lectin_C, 1 hit
SMARTiView protein in SMART
SM00034 CLECT, 1 hit
SUPFAMiSSF56436 SSF56436, 1 hit
PROSITEiView protein in PROSITE
PS50041 C_TYPE_LECTIN_2, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiLAYN_HUMAN
AccessioniPrimary (citable) accession number: Q6UX15
Secondary accession number(s): A6NJB0
, B4DJU0, Q8TAY8, Q96NC5, Q96NF3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 28, 2006
Last sequence update: July 5, 2004
Last modified: November 7, 2018
This is version 119 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again