Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 126 (12 Aug 2020)
Sequence version 2 (10 Jan 2006)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Protein LMBR1L

Gene

LMBR1L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Plays an essential role in lymphocyte development by negatively regulating the canonical Wnt signaling pathway (By similarity). In association with UBAC2 and E3 ubiquitin-protein ligase AMFR, promotes the ubiquitin-mediated degradation of CTNNB1 and Wnt receptors FZD6 and LRP6 (By similarity). LMBR1L stabilizes the beta-catenin destruction complex that is required for regulating CTNNB1 levels (By similarity). Acts as a LCN1 receptor and can mediate its endocytosis (PubMed:11287427, PubMed:12591932, PubMed:23964685).By similarity3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • transmembrane signaling receptor activity Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionReceptor
Biological processEndocytosis, Wnt signaling pathway

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q6UX01

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein LMBR1L
Alternative name(s):
Limb region 1 protein homolog-like
Lipocalin-1-interacting membrane receptor2 Publications
Short name:
LIMR2 Publications
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:LMBR1L
Synonyms:KIAA1174, LIMR
ORF Names:UNQ458/PRO783
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000139636.15

Human Gene Nomenclature Database

More...
HGNCi
HGNC:18268, LMBR1L

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
610007, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6UX01

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 21ExtracellularSequence analysisAdd BLAST21
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular%5Flocation%5Fsection">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei22 – 42HelicalSequence analysisAdd BLAST21
Topological domaini43 – 66CytoplasmicSequence analysisAdd BLAST24
Transmembranei67 – 87HelicalSequence analysisAdd BLAST21
Topological domaini88 – 114ExtracellularSequence analysisAdd BLAST27
Transmembranei115 – 135HelicalSequence analysisAdd BLAST21
Topological domaini136 – 154CytoplasmicSequence analysisAdd BLAST19
Transmembranei155 – 175HelicalSequence analysisAdd BLAST21
Topological domaini176 – 196ExtracellularSequence analysisAdd BLAST21
Transmembranei197 – 217HelicalSequence analysisAdd BLAST21
Topological domaini218 – 305CytoplasmicSequence analysisAdd BLAST88
Transmembranei306 – 326HelicalSequence analysisAdd BLAST21
Topological domaini327 – 350ExtracellularSequence analysisAdd BLAST24
Transmembranei351 – 371HelicalSequence analysisAdd BLAST21
Topological domaini372 – 388CytoplasmicSequence analysisAdd BLAST17
Transmembranei389 – 409HelicalSequence analysisAdd BLAST21
Topological domaini410 – 431ExtracellularSequence analysisAdd BLAST22
Transmembranei432 – 452HelicalSequence analysisAdd BLAST21
Topological domaini453 – 489CytoplasmicSequence analysisAdd BLAST37

Keywords - Cellular componenti

Cell membrane, Endoplasmic reticulum, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000139636

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142671545

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q6UX01, Tbio

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
LMBR1L

Domain mapping of disease mutations (DMDM)

More...
DMDMi
85681040

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000539101 – 489Protein LMBR1LAdd BLAST489

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6UX01

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q6UX01

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q6UX01

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6UX01

PeptideAtlas

More...
PeptideAtlasi
Q6UX01

PRoteomics IDEntifications database

More...
PRIDEi
Q6UX01

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
67540 [Q6UX01-1]
67541 [Q6UX01-2]
67542 [Q6UX01-3]
67543 [Q6UX01-4]
67544 [Q6UX01-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6UX01

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6UX01

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in testis, pituitary gland, adrenal gland, trachea, placenta, thymus, cerebellum, stomach, mammary gland, spinal cord. A weaker expression is detected in colon, pancreas, and prostate.1 Publication

<p>This subsection of the 'Expression' section provides information on the expression of the gene product at various stages of a cell, tissue or organism development. By default, the information is derived from experiments at the mRNA level, unless specified 'at the protein level'.<p><a href='/help/developmental_stage' target='_top'>More...</a></p>Developmental stagei

Expressed in fetal kidney and lung.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000139636, Expressed in left lobe of thyroid gland and 234 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6UX01, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6UX01, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000139636, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Dimer (PubMed:23964685). Can also form higher oligomers (PubMed:23964685).

Interacts with LCN1; this interaction mediates the endocytosis of LCN1 (PubMed:11287427, PubMed:12591932, PubMed:23964685).

Interacts with UBAC2, FAF2, VCP, AMFR, ZNRF3, CTNNB1, LRP6, GSK3A and GSK3B (PubMed:31073040).

Interacts with DVL2 and RNF43 (By similarity). Interaction with SCGB1A1 has been observed in PubMed:16423471, but not in PubMed:23964685 (PubMed:16423471, PubMed:23964685). Interaction with LGB which mediates the endocytosis of LGB has been observed in PubMed:17991420, but not in PubMed:23964685 (PubMed:17991420, PubMed:23964685).

By similarity1 Publication5 Publications

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
120838, 943 interactors

Protein interaction database and analysis system

More...
IntActi
Q6UX01, 4 interactors

Molecular INTeraction database

More...
MINTi
Q6UX01

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000267102

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q6UX01, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 76LCN1-binding1 PublicationAdd BLAST76
Regioni1 – 59Interaction with LGB1 PublicationAdd BLAST59

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the LIMR family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3722, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000007809

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_029445_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6UX01

Identification of Orthologs from Complete Genome Data

More...
OMAi
STGFVGH

Database of Orthologous Groups

More...
OrthoDBi
768229at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6UX01

TreeFam database of animal gene trees

More...
TreeFami
TF313485

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR008075, LIMR
IPR006876, LMBR1-like_membr_prot

The PANTHER Classification System

More...
PANTHERi
PTHR12625, PTHR12625, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04791, LMBR1, 2 hits

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR01692, LIPOCALINIMR

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 12 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6UX01-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEAPDYEVLS VREQLFHERI RECIISTLLF ATLYILCHIF LTRFKKPAEF
60 70 80 90 100
TTVDDEDATV NKIALELCTF TLAIALGAVL LLPFSIISNE VLLSLPRNYY
110 120 130 140 150
IQWLNGSLIH GLWNLVFLFS NLSLIFLMPF AYFFTESEGF AGSRKGVLGR
160 170 180 190 200
VYETVVMLML LTLLVLGMVW VASAIVDKNK ANRESLYDFW EYYLPYLYSC
210 220 230 240 250
ISFLGVLLLL VCTPLGLARM FSVTGKLLVK PRLLEDLEEQ LYCSAFEEAA
260 270 280 290 300
LTRRICNPTS CWLPLDMELL HRQVLALQTQ RVLLEKRRKA SAWQRNLGYP
310 320 330 340 350
LAMLCLLVLT GLSVLIVAIH ILELLIDEAA MPRGMQGTSL GQVSFSKLGS
360 370 380 390 400
FGAVIQVVLI FYLMVSSVVG FYSSPLFRSL RPRWHDTAMT QIIGNCVCLL
410 420 430 440 450
VLSSALPVFS RTLGLTRFDL LGDFGRFNWL GNFYIVFLYN AAFAGLTTLC
460 470 480
LVKTFTAAVR AELIRAFGLD RLPLPVSGFP QASRKTQHQ
Length:489
Mass (Da):55,209
Last modified:January 10, 2006 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i80D169C977F182E2
GO
Isoform 2 (identifier: Q6UX01-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     53-54: Missing.

Show »
Length:487
Mass (Da):54,995
Checksum:iC98C4510D10E9042
GO
Isoform 3 (identifier: Q6UX01-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     336-355: Missing.

Show »
Length:469
Mass (Da):53,244
Checksum:i49FB3525632D3335
GO
Isoform 4 (identifier: Q6UX01-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-52: MEAPDYEVLS...RFKKPAEFTT → MVNVKALCEP...PETSLMTGEP

Show »
Length:484
Mass (Da):53,890
Checksum:i285F0F2180A084E5
GO
Isoform 5 (identifier: Q6UX01-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     363-393: LMVSSVVGFYSSPLFRSLRPRWHDTAMTQII → PSGNPSLPLFSKPVSWDSRPSTSWTLSPLGL
     394-489: Missing.

Show »
Length:393
Mass (Da):44,358
Checksum:i3F3D73D213863E3A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 12 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8VZU8F8VZU8_HUMAN
Protein LMBR1L
LMBR1L
141Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VVE2F8VVE2_HUMAN
Protein LMBR1L
LMBR1L
126Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YI83H0YI83_HUMAN
Protein LMBR1L
LMBR1L
125Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YHZ2H0YHZ2_HUMAN
Protein LMBR1L
LMBR1L
185Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8W054F8W054_HUMAN
Protein LMBR1L
LMBR1L
153Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VYZ9F8VYZ9_HUMAN
Protein LMBR1L
LMBR1L
79Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YIX2H0YIX2_HUMAN
Protein LMBR1L
LMBR1L
92Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E7ESX7E7ESX7_HUMAN
Protein LMBR1L
LMBR1L
153Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WE63F8WE63_HUMAN
Protein LMBR1L
LMBR1L
74Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8VPB1F8VPB1_HUMAN
Protein LMBR1L
LMBR1L
49Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
There are more potential isoformsShow all

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA86488 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti11V → A in BAA91811 (PubMed:14702039).Curated1
Sequence conflicti120S → P in AAQ88935 (PubMed:12975309).Curated1
Sequence conflicti157M → T in BAA91646 (PubMed:14702039).Curated1
Sequence conflicti211V → L in AAH08337 (PubMed:15489334).Curated1
Sequence conflicti334G → V in BAA91646 (PubMed:14702039).Curated1
Sequence conflicti361F → L in BAA86488 (PubMed:10574461).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0168921 – 52MEAPD…AEFTT → MVNVKALCEPEVSNCWMNVI TGTGSVSSPLLVLPQPGPET SLMTGEP in isoform 4. 1 PublicationAdd BLAST52
Alternative sequenceiVSP_01689353 – 54Missing in isoform 2. 1 Publication2
Alternative sequenceiVSP_016894336 – 355Missing in isoform 3. 2 PublicationsAdd BLAST20
Alternative sequenceiVSP_016895363 – 393LMVSS…MTQII → PSGNPSLPLFSKPVSWDSRP STSWTLSPLGL in isoform 5. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_016896394 – 489Missing in isoform 5. 1 PublicationAdd BLAST96

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AF260728 mRNA Translation: AAK60600.1
AF351620 Genomic DNA Translation: AAK63067.1
AB033000 mRNA Translation: BAA86488.1 Different initiation.
AY358572 mRNA Translation: AAQ88935.1
AK001356 mRNA Translation: BAA91646.1
AK001651 mRNA Translation: BAA91811.1
BC008337 mRNA Translation: AAH08337.1
BC015015 mRNA Translation: AAH15015.1
BC031550 mRNA Translation: AAH31550.1
AL137599 mRNA Translation: CAB70835.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS73466.1 [Q6UX01-3]
CCDS8780.2 [Q6UX01-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
T46306

NCBI Reference Sequences

More...
RefSeqi
NP_001287679.1, NM_001300750.1 [Q6UX01-4]
NP_001287680.1, NM_001300751.1 [Q6UX01-3]
NP_060583.2, NM_018113.3 [Q6UX01-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000267102; ENSP00000267102; ENSG00000139636 [Q6UX01-1]
ENST00000547382; ENSP00000447329; ENSG00000139636 [Q6UX01-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
55716

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:55716

UCSC genome browser

More...
UCSCi
uc001rth.5, human [Q6UX01-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF260728 mRNA Translation: AAK60600.1
AF351620 Genomic DNA Translation: AAK63067.1
AB033000 mRNA Translation: BAA86488.1 Different initiation.
AY358572 mRNA Translation: AAQ88935.1
AK001356 mRNA Translation: BAA91646.1
AK001651 mRNA Translation: BAA91811.1
BC008337 mRNA Translation: AAH08337.1
BC015015 mRNA Translation: AAH15015.1
BC031550 mRNA Translation: AAH31550.1
AL137599 mRNA Translation: CAB70835.1
CCDSiCCDS73466.1 [Q6UX01-3]
CCDS8780.2 [Q6UX01-1]
PIRiT46306
RefSeqiNP_001287679.1, NM_001300750.1 [Q6UX01-4]
NP_001287680.1, NM_001300751.1 [Q6UX01-3]
NP_060583.2, NM_018113.3 [Q6UX01-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi120838, 943 interactors
IntActiQ6UX01, 4 interactors
MINTiQ6UX01
STRINGi9606.ENSP00000267102

PTM databases

iPTMnetiQ6UX01
PhosphoSitePlusiQ6UX01

Polymorphism and mutation databases

BioMutaiLMBR1L
DMDMi85681040

Proteomic databases

jPOSTiQ6UX01
MassIVEiQ6UX01
MaxQBiQ6UX01
PaxDbiQ6UX01
PeptideAtlasiQ6UX01
PRIDEiQ6UX01
ProteomicsDBi67540 [Q6UX01-1]
67541 [Q6UX01-2]
67542 [Q6UX01-3]
67543 [Q6UX01-4]
67544 [Q6UX01-5]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
42857, 71 antibodies

The DNASU plasmid repository

More...
DNASUi
55716

Genome annotation databases

EnsembliENST00000267102; ENSP00000267102; ENSG00000139636 [Q6UX01-1]
ENST00000547382; ENSP00000447329; ENSG00000139636 [Q6UX01-3]
GeneIDi55716
KEGGihsa:55716
UCSCiuc001rth.5, human [Q6UX01-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55716
EuPathDBiHostDB:ENSG00000139636.15

GeneCards: human genes, protein and diseases

More...
GeneCardsi
LMBR1L
HGNCiHGNC:18268, LMBR1L
HPAiENSG00000139636, Low tissue specificity
MIMi610007, gene
neXtProtiNX_Q6UX01
OpenTargetsiENSG00000139636
PharmGKBiPA142671545

Human Unidentified Gene-Encoded large proteins database

More...
HUGEi
Search...

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3722, Eukaryota
GeneTreeiENSGT00390000007809
HOGENOMiCLU_029445_1_0_1
InParanoidiQ6UX01
OMAiSTGFVGH
OrthoDBi768229at2759
PhylomeDBiQ6UX01
TreeFamiTF313485

Enzyme and pathway databases

PathwayCommonsiQ6UX01

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
55716, 4 hits in 867 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
LMBR1L, human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
LMBR1L

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
55716
PharosiQ6UX01, Tbio

Protein Ontology

More...
PROi
PR:Q6UX01
RNActiQ6UX01, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000139636, Expressed in left lobe of thyroid gland and 234 other tissues
ExpressionAtlasiQ6UX01, baseline and differential
GenevisibleiQ6UX01, HS

Family and domain databases

InterProiView protein in InterPro
IPR008075, LIMR
IPR006876, LMBR1-like_membr_prot
PANTHERiPTHR12625, PTHR12625, 1 hit
PfamiView protein in Pfam
PF04791, LMBR1, 2 hits
PRINTSiPR01692, LIPOCALINIMR

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiLMBRL_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6UX01
Secondary accession number(s): Q969J4
, Q96BY8, Q96HN8, Q9NT09, Q9NVE1, Q9NVU9, Q9ULP6
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 10, 2006
Last sequence update: January 10, 2006
Last modified: August 12, 2020
This is version 126 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again