Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein FAM198B

Gene

FAM198B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Protein FAM198B
Alternative name(s):
Expressed in nerve and epithelium during development
Gene namesi
Name:FAM198B
Synonyms:C4orf18, ENED
ORF Names:AD021, UNQ2512/PRO6001
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 4

Organism-specific databases

EuPathDBiHostDB:ENSG00000164125.15
HGNCiHGNC:25312 FAM198B
neXtProtiNX_Q6UWH4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 37CytoplasmicSequence analysisAdd BLAST37
Transmembranei38 – 55Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST18
Topological domaini56 – 519ExtracellularSequence analysisAdd BLAST464

Keywords - Cellular componenti

Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi51313
OpenTargetsiENSG00000164125
PharmGKBiPA165664058

Polymorphism and mutation databases

BioMutaiFAM198B
DMDMi74738096

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002888641 – 519Protein FAM198BAdd BLAST519

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi289N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ6UWH4
PeptideAtlasiQ6UWH4
PRIDEiQ6UWH4
ProteomicsDBi67478
67479 [Q6UWH4-2]
67480 [Q6UWH4-3]

PTM databases

iPTMnetiQ6UWH4
PhosphoSitePlusiQ6UWH4

Expressioni

Gene expression databases

BgeeiENSG00000164125 Expressed in 214 organ(s), highest expression level in adrenal gland
CleanExiHS_C4orf18
ExpressionAtlasiQ6UWH4 baseline and differential
GenevisibleiQ6UWH4 HS

Organism-specific databases

HPAiHPA007227

Interactioni

Protein-protein interaction databases

IntActiQ6UWH4, 1 interactor

Structurei

3D structure databases

ProteinModelPortaliQ6UWH4
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the FAM198 family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

GeneTreeiENSGT00420000029769
HOGENOMiHOG000112372
InParanoidiQ6UWH4
OMAiCKLWSSR
OrthoDBiEOG091G04A0
PhylomeDBiQ6UWH4
TreeFamiTF330994

Family and domain databases

InterProiView protein in InterPro
IPR029207 FAM198
PANTHERiPTHR15905 PTHR15905, 1 hit
PfamiView protein in Pfam
PF15051 FAM198, 1 hit

Sequences (3+)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6UWH4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTCPDKPGQL INWFICSLCV PRVRKLWSSR RPRTRRNLLL GTACAIYLGF
60 70 80 90 100
LVSQVGRASL QHGQAAEKGP HRSRDTAEPS FPEIPLDGTL APPESQGNGS
110 120 130 140 150
TLQPNVVYIT LRSKRSKPAN IRGTVKPKRR KKHAVASAAP GQEALVGPSL
160 170 180 190 200
QPQEAAREAD AVAPGYAQGA NLVKIGERPW RLVRGPGVRA GGPDFLQPSS
210 220 230 240 250
RESNIRIYSE SAPSWLSKDD IRRMRLLADS AVAGLRPVSS RSGARLLVLE
260 270 280 290 300
GGAPGAVLRC GPSPCGLLKQ PLDMSEVFAF HLDRILGLNR TLPSVSRKAE
310 320 330 340 350
FIQDGRPCPI ILWDASLSSA SNDTHSSVKL TWGTYQQLLK QKCWQNGRVP
360 370 380 390 400
KPESGCTEIH HHEWSKMALF DFLLQIYNRL DTNCCGFRPR KEDACVQNGL
410 420 430 440 450
RPKCDDQGSA ALAHIIQRKH DPRHLVFIDN KGFFDRSEDN LNFKLLEGIK
460 470 480 490 500
EFPASAVSVL KSQHLRQKLL QSLFLDKVYW ESQGGRQGIE KLIDVIEHRA
510
KILITYINAH GVKVLPMNE
Length:519
Mass (Da):57,552
Last modified:July 5, 2004 - v1
Checksum:i94F6EE648E4CB0BD
GO
Isoform 2 (identifier: Q6UWH4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     304-329: DGRPCPIILWDASLSSASNDTHSSVK → AAAAACLSMRLAFFIFPAWEDMRVPGKCCIGHAR

Show »
Length:527
Mass (Da):58,507
Checksum:i06243CA5BD321A09
GO
Isoform 3 (identifier: Q6UWH4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     304-331: DGRPCPIILWDASLSSASNDTHSSVKLT → GNRFTCFVICSCWGFWFIFFFPSLSFSK
     332-519: Missing.

Note: No experimental confirmation available.
Show »
Length:331
Mass (Da):36,152
Checksum:i70CA02883C7859EB
GO

Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7EN70K7EN70_HUMAN
Protein FAM198B
FAM198B
187Annotation score:
K7ESC5K7ESC5_HUMAN
Protein FAM198B
FAM198B
191Annotation score:
K7EK71K7EK71_HUMAN
Protein FAM198B
FAM198B
108Annotation score:
A0A0G2JLI7A0A0G2JLI7_HUMAN
Protein FAM198B
FAM198B
9Annotation score:

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_032514432G → S1 PublicationCorresponds to variant dbSNP:rs17857283Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_025794304 – 331DGRPC…SVKLT → GNRFTCFVICSCWGFWFIFF FPSLSFSK in isoform 3. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_025795304 – 329DGRPC…HSSVK → AAAAACLSMRLAFFIFPAWE DMRVPGKCCIGHAR in isoform 2. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_025796332 – 519Missing in isoform 3. 1 PublicationAdd BLAST188

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358785 mRNA Translation: AAQ89145.1
AK172805 mRNA Translation: BAD18776.1
BC043193 mRNA Translation: AAH43193.1
BC100016 mRNA Translation: AAI00017.1
CR457196 mRNA Translation: CAG33477.1
CCDSiCCDS34087.1 [Q6UWH4-2]
CCDS3798.1 [Q6UWH4-1]
RefSeqiNP_001026870.2, NM_001031700.2 [Q6UWH4-2]
NP_001121896.1, NM_001128424.1 [Q6UWH4-1]
NP_057697.2, NM_016613.6 [Q6UWH4-1]
UniGeneiHs.567498

Genome annotation databases

EnsembliENST00000296530; ENSP00000296530; ENSG00000164125 [Q6UWH4-1]
ENST00000393807; ENSP00000377396; ENSG00000164125 [Q6UWH4-2]
ENST00000585682; ENSP00000465976; ENSG00000164125 [Q6UWH4-1]
ENST00000592057; ENSP00000466873; ENSG00000164125 [Q6UWH4-3]
GeneIDi51313
KEGGihsa:51313
UCSCiuc003ipp.5 human [Q6UWH4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358785 mRNA Translation: AAQ89145.1
AK172805 mRNA Translation: BAD18776.1
BC043193 mRNA Translation: AAH43193.1
BC100016 mRNA Translation: AAI00017.1
CR457196 mRNA Translation: CAG33477.1
CCDSiCCDS34087.1 [Q6UWH4-2]
CCDS3798.1 [Q6UWH4-1]
RefSeqiNP_001026870.2, NM_001031700.2 [Q6UWH4-2]
NP_001121896.1, NM_001128424.1 [Q6UWH4-1]
NP_057697.2, NM_016613.6 [Q6UWH4-1]
UniGeneiHs.567498

3D structure databases

ProteinModelPortaliQ6UWH4
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ6UWH4, 1 interactor

PTM databases

iPTMnetiQ6UWH4
PhosphoSitePlusiQ6UWH4

Polymorphism and mutation databases

BioMutaiFAM198B
DMDMi74738096

Proteomic databases

MaxQBiQ6UWH4
PeptideAtlasiQ6UWH4
PRIDEiQ6UWH4
ProteomicsDBi67478
67479 [Q6UWH4-2]
67480 [Q6UWH4-3]

Protocols and materials databases

DNASUi51313
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000296530; ENSP00000296530; ENSG00000164125 [Q6UWH4-1]
ENST00000393807; ENSP00000377396; ENSG00000164125 [Q6UWH4-2]
ENST00000585682; ENSP00000465976; ENSG00000164125 [Q6UWH4-1]
ENST00000592057; ENSP00000466873; ENSG00000164125 [Q6UWH4-3]
GeneIDi51313
KEGGihsa:51313
UCSCiuc003ipp.5 human [Q6UWH4-1]

Organism-specific databases

CTDi51313
DisGeNETi51313
EuPathDBiHostDB:ENSG00000164125.15
GeneCardsiFAM198B
HGNCiHGNC:25312 FAM198B
HPAiHPA007227
neXtProtiNX_Q6UWH4
OpenTargetsiENSG00000164125
PharmGKBiPA165664058
GenAtlasiSearch...

Phylogenomic databases

GeneTreeiENSGT00420000029769
HOGENOMiHOG000112372
InParanoidiQ6UWH4
OMAiCKLWSSR
OrthoDBiEOG091G04A0
PhylomeDBiQ6UWH4
TreeFamiTF330994

Miscellaneous databases

ChiTaRSiFAM198B human
GeneWikiiC4orf18
GenomeRNAii51313
PROiPR:Q6UWH4

Gene expression databases

BgeeiENSG00000164125 Expressed in 214 organ(s), highest expression level in adrenal gland
CleanExiHS_C4orf18
ExpressionAtlasiQ6UWH4 baseline and differential
GenevisibleiQ6UWH4 HS

Family and domain databases

InterProiView protein in InterPro
IPR029207 FAM198
PANTHERiPTHR15905 PTHR15905, 1 hit
PfamiView protein in Pfam
PF15051 FAM198, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiF198B_HUMAN
AccessioniPrimary (citable) accession number: Q6UWH4
Secondary accession number(s): Q498Z3
, Q6IAF9, Q6ZMF2, Q86XL0
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: July 5, 2004
Last modified: November 7, 2018
This is version 110 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  3. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again