Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 117 (16 Oct 2019)
Sequence version 1 (05 Jul 2004)
Previous versions | rss
Help videoAdd a publicationFeedback
Protein

Golgi-associated kinase 1B

Gene

GASK1B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:3 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at transcript leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Golgi-associated kinase 1BCurated
Alternative name(s):
Expressed in nerve and epithelium during development
Protein FAM198B
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:GASK1BImported
Synonyms:C4orf18, ENED, FAM198B
ORF Names:AD021, UNQ2512/PRO6001
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25312 GASK1B

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6UWH4

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini1 – 37CytoplasmicSequence analysisAdd BLAST37
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei38 – 55Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST18
Topological domaini56 – 519ExtracellularSequence analysisAdd BLAST464

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Golgi apparatus, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
51313

Open Targets

More...
OpenTargetsi
ENSG00000164125

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA165664058

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q6UWH4

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
FAM198B

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74738096

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002888641 – 519Golgi-associated kinase 1BAdd BLAST519

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi289N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6UWH4

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...
MassIVEi
Q6UWH4

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q6UWH4

PeptideAtlas

More...
PeptideAtlasi
Q6UWH4

PRoteomics IDEntifications database

More...
PRIDEi
Q6UWH4

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
67478 [Q6UWH4-1]
67479 [Q6UWH4-2]
67480 [Q6UWH4-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6UWH4

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6UWH4

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q6UWH4

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000164125 Expressed in 214 organ(s), highest expression level in adrenal gland

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6UWH4 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6UWH4 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA007227

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
119464, 1 interactor

Protein interaction database and analysis system

More...
IntActi
Q6UWH4, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000377396

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the GASK family.Curated

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00420000029769

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000112372

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6UWH4

Identification of Orthologs from Complete Genome Data

More...
OMAi
FLLQIHN

Database of Orthologous Groups

More...
OrthoDBi
451767at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6UWH4

TreeFam database of animal gene trees

More...
TreeFami
TF330994

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR029207 FAM198

The PANTHER Classification System

More...
PANTHERi
PTHR15905 PTHR15905, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15051 FAM198, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6UWH4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MTCPDKPGQL INWFICSLCV PRVRKLWSSR RPRTRRNLLL GTACAIYLGF
60 70 80 90 100
LVSQVGRASL QHGQAAEKGP HRSRDTAEPS FPEIPLDGTL APPESQGNGS
110 120 130 140 150
TLQPNVVYIT LRSKRSKPAN IRGTVKPKRR KKHAVASAAP GQEALVGPSL
160 170 180 190 200
QPQEAAREAD AVAPGYAQGA NLVKIGERPW RLVRGPGVRA GGPDFLQPSS
210 220 230 240 250
RESNIRIYSE SAPSWLSKDD IRRMRLLADS AVAGLRPVSS RSGARLLVLE
260 270 280 290 300
GGAPGAVLRC GPSPCGLLKQ PLDMSEVFAF HLDRILGLNR TLPSVSRKAE
310 320 330 340 350
FIQDGRPCPI ILWDASLSSA SNDTHSSVKL TWGTYQQLLK QKCWQNGRVP
360 370 380 390 400
KPESGCTEIH HHEWSKMALF DFLLQIYNRL DTNCCGFRPR KEDACVQNGL
410 420 430 440 450
RPKCDDQGSA ALAHIIQRKH DPRHLVFIDN KGFFDRSEDN LNFKLLEGIK
460 470 480 490 500
EFPASAVSVL KSQHLRQKLL QSLFLDKVYW ESQGGRQGIE KLIDVIEHRA
510
KILITYINAH GVKVLPMNE
Length:519
Mass (Da):57,552
Last modified:July 5, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i94F6EE648E4CB0BD
GO
Isoform 2 (identifier: Q6UWH4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     304-329: DGRPCPIILWDASLSSASNDTHSSVK → AAAAACLSMRLAFFIFPAWEDMRVPGKCCIGHAR

Show »
Length:527
Mass (Da):58,507
Checksum:i06243CA5BD321A09
GO
Isoform 3 (identifier: Q6UWH4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     304-331: DGRPCPIILWDASLSSASNDTHSSVKLT → GNRFTCFVICSCWGFWFIFFFPSLSFSK
     332-519: Missing.

Note: No experimental confirmation available.
Show »
Length:331
Mass (Da):36,152
Checksum:i70CA02883C7859EB
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
K7EN70K7EN70_HUMAN
Golgi-associated kinase 1B
GASK1B
187Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7ESC5K7ESC5_HUMAN
Golgi-associated kinase 1B
GASK1B
191Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
K7EK71K7EK71_HUMAN
Golgi-associated kinase 1B
GASK1B
108Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JLI7A0A0G2JLI7_HUMAN
Golgi-associated kinase 1B
GASK1B
9Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_032514432G → S1 PublicationCorresponds to variant dbSNP:rs17857283Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_025794304 – 331DGRPC…SVKLT → GNRFTCFVICSCWGFWFIFF FPSLSFSK in isoform 3. 1 PublicationAdd BLAST28
Alternative sequenceiVSP_025795304 – 329DGRPC…HSSVK → AAAAACLSMRLAFFIFPAWE DMRVPGKCCIGHAR in isoform 2. 1 PublicationAdd BLAST26
Alternative sequenceiVSP_025796332 – 519Missing in isoform 3. 1 PublicationAdd BLAST188

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY358785 mRNA Translation: AAQ89145.1
AK172805 mRNA Translation: BAD18776.1
BC043193 mRNA Translation: AAH43193.1
BC100016 mRNA Translation: AAI00017.1
CR457196 mRNA Translation: CAG33477.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS34087.1 [Q6UWH4-2]
CCDS3798.1 [Q6UWH4-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001026870.2, NM_001031700.2 [Q6UWH4-2]
NP_001121896.1, NM_001128424.1 [Q6UWH4-1]
NP_057697.2, NM_016613.6 [Q6UWH4-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000296530; ENSP00000296530; ENSG00000164125 [Q6UWH4-1]
ENST00000393807; ENSP00000377396; ENSG00000164125 [Q6UWH4-2]
ENST00000585682; ENSP00000465976; ENSG00000164125 [Q6UWH4-1]
ENST00000592057; ENSP00000466873; ENSG00000164125 [Q6UWH4-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
51313

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:51313

UCSC genome browser

More...
UCSCi
uc003ipp.5 human [Q6UWH4-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358785 mRNA Translation: AAQ89145.1
AK172805 mRNA Translation: BAD18776.1
BC043193 mRNA Translation: AAH43193.1
BC100016 mRNA Translation: AAI00017.1
CR457196 mRNA Translation: CAG33477.1
CCDSiCCDS34087.1 [Q6UWH4-2]
CCDS3798.1 [Q6UWH4-1]
RefSeqiNP_001026870.2, NM_001031700.2 [Q6UWH4-2]
NP_001121896.1, NM_001128424.1 [Q6UWH4-1]
NP_057697.2, NM_016613.6 [Q6UWH4-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi119464, 1 interactor
IntActiQ6UWH4, 1 interactor
STRINGi9606.ENSP00000377396

PTM databases

iPTMnetiQ6UWH4
PhosphoSitePlusiQ6UWH4
SwissPalmiQ6UWH4

Polymorphism and mutation databases

BioMutaiFAM198B
DMDMi74738096

Proteomic databases

jPOSTiQ6UWH4
MassIVEiQ6UWH4
MaxQBiQ6UWH4
PeptideAtlasiQ6UWH4
PRIDEiQ6UWH4
ProteomicsDBi67478 [Q6UWH4-1]
67479 [Q6UWH4-2]
67480 [Q6UWH4-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
51313

Genome annotation databases

EnsembliENST00000296530; ENSP00000296530; ENSG00000164125 [Q6UWH4-1]
ENST00000393807; ENSP00000377396; ENSG00000164125 [Q6UWH4-2]
ENST00000585682; ENSP00000465976; ENSG00000164125 [Q6UWH4-1]
ENST00000592057; ENSP00000466873; ENSG00000164125 [Q6UWH4-3]
GeneIDi51313
KEGGihsa:51313
UCSCiuc003ipp.5 human [Q6UWH4-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
51313
DisGeNETi51313

GeneCards: human genes, protein and diseases

More...
GeneCardsi
GASK1B
HGNCiHGNC:25312 GASK1B
HPAiHPA007227
neXtProtiNX_Q6UWH4
OpenTargetsiENSG00000164125
PharmGKBiPA165664058

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

GeneTreeiENSGT00420000029769
HOGENOMiHOG000112372
InParanoidiQ6UWH4
OMAiFLLQIHN
OrthoDBi451767at2759
PhylomeDBiQ6UWH4
TreeFamiTF330994

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
FAM198B human

The Gene Wiki collection of pages on human genes and proteins

More...
GeneWikii
C4orf18

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
51313
PharosiQ6UWH4

Protein Ontology

More...
PROi
PR:Q6UWH4

Gene expression databases

BgeeiENSG00000164125 Expressed in 214 organ(s), highest expression level in adrenal gland
ExpressionAtlasiQ6UWH4 baseline and differential
GenevisibleiQ6UWH4 HS

Family and domain databases

InterProiView protein in InterPro
IPR029207 FAM198
PANTHERiPTHR15905 PTHR15905, 1 hit
PfamiView protein in Pfam
PF15051 FAM198, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiGAK1B_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6UWH4
Secondary accession number(s): Q498Z3
, Q6IAF9, Q6ZMF2, Q86XL0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 29, 2007
Last sequence update: July 5, 2004
Last modified: October 16, 2019
This is version 117 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again