Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 106 (08 May 2019)
Sequence version 1 (05 Jul 2004)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

SLP adapter and CSK-interacting membrane protein

Gene

SCIMP

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Lipid tetraspanin-associated transmembrane adapter/mediator involved in major histocompatibility complex (MHC) class II signaling transduction. Required in generating the calcium response and enhancing ERK activity upon MHC-II stimulation.1 Publication

Caution

It is uncertain whether Met-1 or Met-12 is the initiator.Curated

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
SLP adapter and CSK-interacting membrane protein
Alternative name(s):
SLP65/SLP76, Csk-interacting membrane protein
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SCIMP
Synonyms:C17orf87
ORF Names:UNQ5783/PRO16090
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 17

Organism-specific databases

Human Gene Nomenclature Database

More...
HGNCi
HGNC:33504 SCIMP

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
614406 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6UWF3

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei19 – 39HelicalSequence analysisAdd BLAST21

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi69Y → F: Inhibits interaction with GRB2. 1 Publication1
Mutagenesisi107Y → F: Inhibits interaction with CSK. Stimulates activation of several downstream signaling pathways. 1 Publication1
Mutagenesisi131Y → F: Inhibits interaction with BLNK. Inhibits activation of several downstream signaling pathways. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
388325

Open Targets

More...
OpenTargetsi
ENSG00000161929

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162378517

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SCIMP

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74738081

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002952371 – 145SLP adapter and CSK-interacting membrane proteinAdd BLAST145

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position(s) and the type of covalently attached lipid group(s).<p><a href='/help/lipid' target='_top'>More...</a></p>Lipidationi40S-palmitoyl cysteine1 Publication1
Lipidationi42S-palmitoyl cysteine1 Publication1
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei76PhosphoserineBy similarity1
Modified residuei131PhosphotyrosineBy similarity1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated. Phosphorylation occurs on tyrosine residues by tyrosine-protein kinases LYN and SRC upon MHC-II stimulation.1 Publication
Palmitoylated.1 Publication

Keywords - PTMi

Lipoprotein, Palmitate, Phosphoprotein

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6UWF3

PeptideAtlas

More...
PeptideAtlasi
Q6UWF3

PRoteomics IDEntifications database

More...
PRIDEi
Q6UWF3

ProteomicsDB human proteome resource

More...
ProteomicsDBi
67470
67471 [Q6UWF3-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6UWF3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6UWF3

SwissPalm database of S-palmitoylation events

More...
SwissPalmi
Q6UWF3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed in antigen-presenting cells, like peripheral blood leukocytes and monocyte-derived dendritic cells (MDDC) (at protein level). Highly expressed in lymph nodes and spleen. Expressed in antigen-presenting cells. Faintly expressed in the majority of nonimmune system tissues.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000161929 Expressed in 95 organ(s), highest expression level in leukocyte

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6UWF3 baseline and differential

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA006117

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with CD37, CD53 and CD81. Interacts with BLNK and GRB2 isoform 1. Interacts (via prolin-rich region) with LYN (via SH3 domain). Interacts with CSK (via SH2 domain).1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
132643, 1 interactor

Protein interaction database and analysis system

More...
IntActi
Q6UWF3, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000461269

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi57 – 137Pro-richAdd BLAST81

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG410J1IN Eukaryota
ENOG41114KD LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000007003

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000015337

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6UWF3

Identification of Orthologs from Complete Genome Data

More...
OMAi
WQLRQGK

Database of Orthologous Groups

More...
OrthoDBi
1442988at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6UWF3

TreeFam database of animal gene trees

More...
TreeFami
TF340362

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR028181 SCIMP

The PANTHER Classification System

More...
PANTHERi
PTHR12044:SF11 PTHR12044:SF11, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF15050 SCIMP, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6UWF3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDTFTVQDST AMSWWRNNFW IILAVAIIVV SVGLGLILYC VCKWQLRRGK
60 70 80 90 100
KWEIAKPLKH KQVDEEKMYE NVLNESPVQL PPLPPRNWPS LEDSSPQEAP
110 120 130 140
SQPPATYSLV NKVKNKKTVS IPSYIEPEDD YDDVEIPANT EKASF
Length:145
Mass (Da):16,618
Last modified:July 5, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8093F1087A7428EF
GO
Isoform 2 (identifier: Q6UWF3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     43-49: Missing.
     95-130: SPQEAPSQPPATYSLVNKVKNKKTVSIPSYIEPEDD → YGVLLCHPGWSAMARSRLTASSASRVHAILLPQPPE
     131-145: Missing.

Note: No experimental confirmation available.
Show »
Length:123
Mass (Da):13,927
Checksum:i428E197CD758F717
GO
Isoform 3 (identifier: Q6UWF3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     43-49: Missing.

Show »
Length:138
Mass (Da):15,693
Checksum:iB782EA12EEF75192
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
I3L1W2I3L1W2_HUMAN
SLP adapter and CSK-interacting mem...
SCIMP
130Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_02685343 – 49Missing in isoform 2 and isoform 3. 3 Publications7
Alternative sequenceiVSP_02685495 – 130SPQEA…EPEDD → YGVLLCHPGWSAMARSRLTA SSASRVHAILLPQPPE in isoform 2. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_026855131 – 145Missing in isoform 2. 1 PublicationAdd BLAST15

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY358809 mRNA Translation: AAQ89169.1
AK057142 mRNA No translation available.
AK297035 mRNA Translation: BAG59563.1
DQ778084 mRNA Translation: ABI63348.1
AC087500 Genomic DNA No translation available.
CH471108 Genomic DNA Translation: EAW90349.1
CH471108 Genomic DNA Translation: EAW90350.1
BC127925 mRNA Translation: AAI27926.1
BC130554 mRNA Translation: AAI30555.1
BC130556 mRNA Translation: AAI30557.1
BC144395 mRNA Translation: AAI44396.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS42242.1 [Q6UWF3-1]
CCDS62044.1 [Q6UWF3-3]
CCDS82046.1 [Q6UWF3-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001258771.1, NM_001271842.1 [Q6UWF3-3]
NP_001306119.1, NM_001319190.1 [Q6UWF3-2]
NP_996986.1, NM_207103.3 [Q6UWF3-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000399600; ENSP00000382509; ENSG00000161929 [Q6UWF3-3]
ENST00000571800; ENSP00000459605; ENSG00000161929 [Q6UWF3-2]
ENST00000574081; ENSP00000461269; ENSG00000161929 [Q6UWF3-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
388325

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:388325

UCSC genome browser

More...
UCSCi
uc002gbh.4 human [Q6UWF3-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY358809 mRNA Translation: AAQ89169.1
AK057142 mRNA No translation available.
AK297035 mRNA Translation: BAG59563.1
DQ778084 mRNA Translation: ABI63348.1
AC087500 Genomic DNA No translation available.
CH471108 Genomic DNA Translation: EAW90349.1
CH471108 Genomic DNA Translation: EAW90350.1
BC127925 mRNA Translation: AAI27926.1
BC130554 mRNA Translation: AAI30555.1
BC130556 mRNA Translation: AAI30557.1
BC144395 mRNA Translation: AAI44396.1
CCDSiCCDS42242.1 [Q6UWF3-1]
CCDS62044.1 [Q6UWF3-3]
CCDS82046.1 [Q6UWF3-2]
RefSeqiNP_001258771.1, NM_001271842.1 [Q6UWF3-3]
NP_001306119.1, NM_001319190.1 [Q6UWF3-2]
NP_996986.1, NM_207103.3 [Q6UWF3-1]

3D structure databases

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

SWISS-MODEL Interactive Workspace

More...
SWISS-MODEL-Workspacei
Submit a new modelling project...

Protein-protein interaction databases

BioGridi132643, 1 interactor
IntActiQ6UWF3, 2 interactors
STRINGi9606.ENSP00000461269

PTM databases

iPTMnetiQ6UWF3
PhosphoSitePlusiQ6UWF3
SwissPalmiQ6UWF3

Polymorphism and mutation databases

BioMutaiSCIMP
DMDMi74738081

Proteomic databases

PaxDbiQ6UWF3
PeptideAtlasiQ6UWF3
PRIDEiQ6UWF3
ProteomicsDBi67470
67471 [Q6UWF3-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
388325
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000399600; ENSP00000382509; ENSG00000161929 [Q6UWF3-3]
ENST00000571800; ENSP00000459605; ENSG00000161929 [Q6UWF3-2]
ENST00000574081; ENSP00000461269; ENSG00000161929 [Q6UWF3-1]
GeneIDi388325
KEGGihsa:388325
UCSCiuc002gbh.4 human [Q6UWF3-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
388325
DisGeNETi388325

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SCIMP

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0013465
HGNCiHGNC:33504 SCIMP
HPAiHPA006117
MIMi614406 gene
neXtProtiNX_Q6UWF3
OpenTargetsiENSG00000161929
PharmGKBiPA162378517

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG410J1IN Eukaryota
ENOG41114KD LUCA
GeneTreeiENSGT00390000007003
HOGENOMiHOG000015337
InParanoidiQ6UWF3
OMAiWQLRQGK
OrthoDBi1442988at2759
PhylomeDBiQ6UWF3
TreeFamiTF340362

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
388325

Protein Ontology

More...
PROi
PR:Q6UWF3

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000161929 Expressed in 95 organ(s), highest expression level in leukocyte
ExpressionAtlasiQ6UWF3 baseline and differential

Family and domain databases

InterProiView protein in InterPro
IPR028181 SCIMP
PANTHERiPTHR12044:SF11 PTHR12044:SF11, 1 hit
PfamiView protein in Pfam
PF15050 SCIMP, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSCIMP_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6UWF3
Secondary accession number(s): A6XGL4, B4DLK1, Q96MD0
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 10, 2007
Last sequence update: July 5, 2004
Last modified: May 8, 2019
This is version 106 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again