Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cytochrome P450 20A1

Gene

CYP20A1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Cofactori

hemeBy similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi409Iron (heme axial ligand)By similarity1

GO - Molecular functioni

Keywordsi

Molecular functionMonooxygenase, Oxidoreductase
LigandHeme, Iron, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Cytochrome P450 20A1 (EC:1.14.-.-)
Gene namesi
Name:CYP20A1
ORF Names:UNQ667/PRO1301
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000119004.14
HGNCiHGNC:20576 CYP20A1
neXtProtiNX_Q6UW02

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei4 – 24HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi57404
OpenTargetsiENSG00000119004
PharmGKBiPA134911420

Polymorphism and mutation databases

BioMutaiCYP20A1
DMDMi74749375

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003180951 – 462Cytochrome P450 20A1Add BLAST462

Proteomic databases

EPDiQ6UW02
MaxQBiQ6UW02
PaxDbiQ6UW02
PeptideAtlasiQ6UW02
PRIDEiQ6UW02
ProteomicsDBi67441

PTM databases

iPTMnetiQ6UW02
PhosphoSitePlusiQ6UW02

Expressioni

Gene expression databases

BgeeiENSG00000119004 Expressed in 179 organ(s), highest expression level in adrenal tissue
CleanExiHS_CYP20A1
ExpressionAtlasiQ6UW02 baseline and differential
GenevisibleiQ6UW02 HS

Organism-specific databases

HPAiHPA055872
HPA058461

Interactioni

Protein-protein interaction databases

BioGridi121506, 6 interactors
IntActiQ6UW02, 1 interactor
STRINGi9606.ENSP00000348380

Structurei

3D structure databases

ProteinModelPortaliQ6UW02
SMRiQ6UW02
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the cytochrome P450 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0157 Eukaryota
COG2124 LUCA
GeneTreeiENSGT00500000044939
HOGENOMiHOG000111913
HOVERGENiHBG076231
InParanoidiQ6UW02
KOiK07435
PhylomeDBiQ6UW02
TreeFamiTF105089

Family and domain databases

Gene3Di1.10.630.10, 1 hit
InterProiView protein in InterPro
IPR001128 Cyt_P450
IPR002401 Cyt_P450_E_grp-I
IPR036396 Cyt_P450_sf
PfamiView protein in Pfam
PF00067 p450, 1 hit
PRINTSiPR00463 EP450I
SUPFAMiSSF48264 SSF48264, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 5 potential isoforms that are computationally mapped.iShow all

Isoform 1 (identifier: Q6UW02-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLDFAIFAVT FLLALVGAVL YLYPASRQAA GIPGITPTEE KDGNLPDIVN
60 70 80 90 100
SGSLHEFLVN LHERYGPVVS FWFGRRLVVS LGTVDVLKQH INPNKTSDPF
110 120 130 140 150
ETMLKSLLRY QSGGGSVSEN HMRKKLYENG VTDSLKSNFA LLLKLSEELL
160 170 180 190 200
DKWLSYPETQ HVPLSQHMLG FAMKSVTQMV MGSTFEDDQE VIRFQKNHGT
210 220 230 240 250
VWSEIGKGFL DGSLDKNMTR KKQYEDALMQ LESVLRNIIK ERKGRNFSQH
260 270 280 290 300
IFIDSLVQGN LNDQQILEDS MIFSLASCII TAKLCTWAIC FLTTSEEVQK
310 320 330 340 350
KLYEEINQVF GNGPVTPEKI EQLRYCQHVL CETVRTAKLT PVSAQLQDIE
360 370 380 390 400
GKIDRFIIPR ETLVLYALGV VLQDPNTWPS PHKFDPDRFD DELVMKTFSS
410 420 430 440 450
LGFSGTQECP ELRFAYMVTT VLLSVLVKRL HLLSVEGQVI ETKYELVTSS
460
REEAWITVSK RY
Length:462
Mass (Da):52,432
Last modified:July 5, 2004 - v1
Checksum:i4C0FEFFA0B9B055A
GO
Isoform 2 (identifier: Q6UW02-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     201-251: VWSEIGKGFLDGSLDKNMTRKKQYEDALMQLESVLRNIIKERKGRNFSQHI → PSCNWSLFKEHHKRTKRKELQSTY

Show »
Length:435
Mass (Da):49,428
Checksum:i3D3C3F46D0312978
GO

Computationally mapped potential isoform sequencesi

There are 5 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q8WZ13Q8WZ13_HUMAN
Cytochrome P450 20A1
CYP20A1
192Annotation score:
E9PHG5E9PHG5_HUMAN
Cytochrome P450 20A1
CYP20A1
470Annotation score:
F8WBE2F8WBE2_HUMAN
Cytochrome P450 20A1
CYP20A1
208Annotation score:
C9J8K7C9J8K7_HUMAN
Cytochrome P450 20A1
CYP20A1
258Annotation score:
F2Z3K6F2Z3K6_HUMAN
Cytochrome P450 20A1
CYP20A1
44Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti77L → V in AAG09681 (Ref. 1) Curated1
Sequence conflicti124K → E in AAH20616 (PubMed:15489334).Curated1
Sequence conflicti333 – 334TV → LF in AAG09681 (Ref. 1) Curated2

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05915397S → L2 PublicationsCorresponds to variant dbSNP:rs2043449Ensembl.1
Natural variantiVAR_059154346L → FCombined sources2 PublicationsCorresponds to variant dbSNP:rs1048013Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_055585201 – 251VWSEI…FSQHI → PSCNWSLFKEHHKRTKRKEL QSTY in isoform 2. 1 PublicationAdd BLAST51

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF183412 mRNA Translation: AAG09681.1
AY359068 mRNA Translation: AAQ89427.1
AC011737 Genomic DNA Translation: AAX88915.1
BC020616 mRNA Translation: AAH20616.1
BC033752 mRNA Translation: AAH33752.1
CCDSiCCDS2357.1 [Q6UW02-1]
RefSeqiNP_803882.1, NM_177538.2 [Q6UW02-1]
UniGeneiHs.446065
Hs.707756

Genome annotation databases

EnsembliENST00000356079; ENSP00000348380; ENSG00000119004 [Q6UW02-1]
GeneIDi57404
KEGGihsa:57404
UCSCiuc002uzv.5 human [Q6UW02-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiCP20A_HUMAN
AccessioniPrimary (citable) accession number: Q6UW02
Secondary accession number(s): Q4ZG61
, Q8N4Q8, Q8WWA9, Q9HC04
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: July 5, 2004
Last modified: September 12, 2018
This is version 130 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again