Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

SHC-transforming protein 4

Gene

SHC4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Activates both Ras-dependent and Ras-independent migratory pathways in melanomas. Contributes to the early phases of agrin-induced tyrosine phosphorylation of CHRNB1.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • protein domain specific binding Source: Ensembl
  • receptor tyrosine kinase binding Source: GO_Central

GO - Biological processi

Enzyme and pathway databases

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q6S5L8

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
SHC-transforming protein 4
Alternative name(s):
Rai-like protein
Short name:
RaLP
SHC-transforming protein D
Short name:
hShcD
Src homology 2 domain-containing-transforming protein C4
Short name:
SH2 domain protein C4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SHC4
Synonyms:SHCD
ORF Names:UNQ6438/PRO21364
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000185634.11

Human Gene Nomenclature Database

More...
HGNCi
HGNC:16743 SHC4

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
617372 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6S5L8

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell junction, Cell membrane, Membrane, Postsynaptic cell membrane, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi315R → Q: Phosphorylation is markedly decreased. Completely reduces the phosphorylation and interaction with MUSK; when associated with K-549. 1 Publication1
Mutagenesisi374 – 375YY → F: Remains phosphorylated. Contains a residual phosphorylation; when associated with F-465. Retains the ability to bind MUSK. Reduced the phosphorylation in presence of MUSK; when associated with F-424 and F-465. Completely abolishes the phosphorylation in presence of MUSK; when associated with F-403; F-413; F-424 and F-465. Retains the ability to bind MUSK; when associated with F-465. Retains the ability to bind MUSK; when associated with F-424 and F-465. Retains the ability to bind MUSK; when associated with F-403; F-413; F-424 and F-465. 1 Publication2
Mutagenesisi403Y → F: Completely abolishes the phosphorylation in presence of MUSK; when associated with 374-F-F-375; F-413; F-424 and F-465. 1 Publication1
Mutagenesisi413Y → F: Completely abolishes the phosphorylation in presence of MUSK; when associated with 374-F-F-375; F-403; F-424 and F-465. 1 Publication1
Mutagenesisi424Y → F: Significantly decreased GRB2 interaction. Reduced the phosphorylation in presence of MUSK; when associated with 374-F-F-375 and F-465. Completely abolishes the phosphorylation in presence of MUSK; when associated with 374-F-F-375; F-403; F-413 and F-465. 1 Publication1
Mutagenesisi465Y → F: Remains phosphorylated. Contains a residual phosphorylation; when associated with 374-F-F-375. Reduced the phosphorylation in presence of MUSK; when associated with 374-F-F-375 and 424. Completely abolishes the phosphorylation in presence of MUSK; when associated with 374-F-F-375; F-403; F-413 and F-424. Retains the ability to bind MUSK. Retains the ability to bind MUSK; when associated with 374-F-F-375. Retains the ability to bind MUSK; when associated with 374-F-F-375 and F-424. Retains the ability to bind MUSK; when associated with 374-F-F-375; F-403; F-413 and F-424. 1 Publication1
Mutagenesisi549R → K: Completely reduces the phosphorylation and interaction with MUSK; when associated with Q-315. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
399694

Open Targets

More...
OpenTargetsi
ENSG00000185634

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142670917

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SHC4

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74722804

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003372001 – 630SHC-transforming protein 4Add BLAST630

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei424Phosphotyrosine1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Phosphorylated; the phosphorylation is enhanced by EGF. Phosphorylation at Tyr-424 is required for the interaction with GRB2.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q6S5L8

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6S5L8

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q6S5L8

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6S5L8

PeptideAtlas

More...
PeptideAtlasi
Q6S5L8

PRoteomics IDEntifications database

More...
PRIDEi
Q6S5L8

ProteomicsDB human proteome resource

More...
ProteomicsDBi
67342
67343 [Q6S5L8-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6S5L8

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6S5L8

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Only expressed in melanomas. Weakly expressed in normal melanocytes and benign nevi. Highly expressed at the transition from radial growth phase to vertical growth phase and metastatic melanomas, when tumor cells acquire migratory competence and invasive potential.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000185634 Expressed in 144 organ(s), highest expression level in brain

CleanEx database of gene expression profiles

More...
CleanExi
HS_SHC4

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6S5L8 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6S5L8 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA074146

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via PID domain) with phosphorylated MUSK (via NPXY motif); undergoes tyrosine phosphorylation downstream of activated MUSK. Interacts with GRB2; the interaction is dependent of Tyr-424 phosphorylation and increased by EGF.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
134386, 9 interactors

Protein interaction database and analysis system

More...
IntActi
Q6S5L8, 4 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000329668

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q6S5L8

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6S5L8

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini186 – 369PIDPROSITE-ProRule annotationAdd BLAST184
Domaini526 – 617SH2PROSITE-ProRule annotationAdd BLAST92

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni1 – 185CH2Add BLAST185
Regioni370 – 525CH1Add BLAST156

Keywords - Domaini

SH2 domain

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3697 Eukaryota
ENOG410XTJN LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000153127

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000231974

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG050121

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6S5L8

KEGG Orthology (KO)

More...
KOi
K17449

Identification of Orthologs from Complete Genome Data

More...
OMAi
YYVRYMG

Database of Orthologous Groups

More...
OrthoDBi
1351843at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6S5L8

TreeFam database of animal gene trees

More...
TreeFami
TF315807

Family and domain databases

Conserved Domains Database

More...
CDDi
cd01209 PTB_Shc, 1 hit
cd09925 SH2_SHC, 1 hit

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.30.29.30, 1 hit
3.30.505.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011993 PH-like_dom_sf
IPR006019 PID_Shc-like
IPR006020 PTB/PI_dom
IPR000980 SH2
IPR036860 SH2_dom_sf
IPR029596 SHC4
IPR035676 SHC_SH2

The PANTHER Classification System

More...
PANTHERi
PTHR10337:SF12 PTHR10337:SF12, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00640 PID, 1 hit
PF00017 SH2, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00401 SH2DOMAIN
PR00629 SHCPIDOMAIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00462 PTB, 1 hit
SM00252 SH2, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF55550 SSF55550, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS01179 PID, 1 hit
PS50001 SH2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6S5L8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MRERGQDSLA GLVLYVGLFG HPGMLHRAKY SRFRNESITS LDEGSSGGSV
60 70 80 90 100
GNKGSPQPPH PALAPHLPTE DATLPSQESP TPLCTLIPRM ASMKLANPAT
110 120 130 140 150
LLSLKNFCLG TKEVPRLKLQ ESRDPGSSGP SSPETSLSRS GTAPPPQQDL
160 170 180 190 200
VGHRATALTP DSCPLPGPGE PTLRSRQDRH FLQHLLGMGM NYCVRYMGCV
210 220 230 240 250
EVLQSMRSLD FGMRTQVTRE AISRLCEAVP GANGAIKKRK PPVKFLSTVL
260 270 280 290 300
GKSNLQFSGM NIKLTISTCS LTLMNLDNQQ IIANHHMQSI SFASGGDPDT
310 320 330 340 350
TDYVAYVAKD PVNQRACHIL ECHNGMAQDV ISTIGQAFEL RFKQYLKNPS
360 370 380 390 400
LNTSCESEEV HIDSHAEERE DHEYYNEIPG KQPPVGGVSD MRIKVQATEQ
410 420 430 440 450
MAYCPIQCEK LCYLPGNSKC SSVYENCLEQ SRAIGNVHPR GVQSQRDTSL
460 470 480 490 500
LKHTCRVDLF DDPCYINTQA LQSTPGSAGN QRSAQPLGSP WHCGKAPETV
510 520 530 540 550
QPGATAQPAS SHSLPHIKQQ LWSEECYHGK LSRKAAESLL VKDGDFLVRE
560 570 580 590 600
SATSPGQYVL SGLQGGQAKH LLLVDPEGKV RTKDHVFDNV GHLIRYHMDN
610 620 630
SLPIISSGSE VSLKQPVRKD NNPALLHSNK
Length:630
Mass (Da):68,785
Last modified:July 5, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i504F3FCB894E2C59
GO
Isoform 2 (identifier: Q6S5L8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-243: Missing.
     244-280: KFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNLDNQQ → MLPALEHWIPKFFSFRTRTGSPLSLACRQPIVGPCDH

Note: No experimental confirmation available.
Show »
Length:387
Mass (Da):42,782
Checksum:i558D4E2167B69AF7
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5H5M1F5H5M1_HUMAN
SHC-transforming protein 4
SHC4
344Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YLU6H0YLU6_HUMAN
SHC-transforming protein 4
SHC4
144Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H0YLZ2H0YLZ2_HUMAN
SHC-transforming protein 4
SHC4
128Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04367252N → D1 PublicationCorresponds to variant dbSNP:rs17856991Ensembl.1
Natural variantiVAR_043673244K → E1 PublicationCorresponds to variant dbSNP:rs17856990Ensembl.1
Natural variantiVAR_043674400Q → H. Corresponds to variant dbSNP:rs16961728Ensembl.1
Natural variantiVAR_043675447D → G1 PublicationCorresponds to variant dbSNP:rs17856992Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0339651 – 243Missing in isoform 2. 1 PublicationAdd BLAST243
Alternative sequenceiVSP_033966244 – 280KFLST…LDNQQ → MLPALEHWIPKFFSFRTRTG SPLSLACRQPIVGPCDH in isoform 2. 1 PublicationAdd BLAST37

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY464565 mRNA Translation: AAR19363.1
AY358250 mRNA Translation: AAQ88617.1
BC033907 mRNA Translation: AAH33907.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS10130.1 [Q6S5L8-1]

NCBI Reference Sequences

More...
RefSeqi
NP_976224.3, NM_203349.3 [Q6S5L8-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.642615

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000332408; ENSP00000329668; ENSG00000185634 [Q6S5L8-1]
ENST00000396535; ENSP00000379786; ENSG00000185634 [Q6S5L8-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
399694

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:399694

UCSC genome browser

More...
UCSCi
uc001zxb.2 human [Q6S5L8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

<p>This subsection of the <a href="http://www.uniprot.org/manual/cross_references_section">Cross-references</a> section provides links to various web resources that are relevant for a specific protein.<p><a href='/help/web_resource' target='_top'>More...</a></p>Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY464565 mRNA Translation: AAR19363.1
AY358250 mRNA Translation: AAQ88617.1
BC033907 mRNA Translation: AAH33907.1
CCDSiCCDS10130.1 [Q6S5L8-1]
RefSeqiNP_976224.3, NM_203349.3 [Q6S5L8-1]
UniGeneiHs.642615

3D structure databases

ProteinModelPortaliQ6S5L8
SMRiQ6S5L8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi134386, 9 interactors
IntActiQ6S5L8, 4 interactors
STRINGi9606.ENSP00000329668

PTM databases

iPTMnetiQ6S5L8
PhosphoSitePlusiQ6S5L8

Polymorphism and mutation databases

BioMutaiSHC4
DMDMi74722804

Proteomic databases

EPDiQ6S5L8
jPOSTiQ6S5L8
MaxQBiQ6S5L8
PaxDbiQ6S5L8
PeptideAtlasiQ6S5L8
PRIDEiQ6S5L8
ProteomicsDBi67342
67343 [Q6S5L8-2]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000332408; ENSP00000329668; ENSG00000185634 [Q6S5L8-1]
ENST00000396535; ENSP00000379786; ENSG00000185634 [Q6S5L8-2]
GeneIDi399694
KEGGihsa:399694
UCSCiuc001zxb.2 human [Q6S5L8-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
399694
DisGeNETi399694
EuPathDBiHostDB:ENSG00000185634.11

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SHC4

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0202177
HGNCiHGNC:16743 SHC4
HPAiHPA074146
MIMi617372 gene
neXtProtiNX_Q6S5L8
OpenTargetsiENSG00000185634
PharmGKBiPA142670917

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3697 Eukaryota
ENOG410XTJN LUCA
GeneTreeiENSGT00940000153127
HOGENOMiHOG000231974
HOVERGENiHBG050121
InParanoidiQ6S5L8
KOiK17449
OMAiYYVRYMG
OrthoDBi1351843at2759
PhylomeDBiQ6S5L8
TreeFamiTF315807

Enzyme and pathway databases

SignaLinkiQ6S5L8

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
SHC4 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
399694

Protein Ontology

More...
PROi
PR:Q6S5L8

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000185634 Expressed in 144 organ(s), highest expression level in brain
CleanExiHS_SHC4
ExpressionAtlasiQ6S5L8 baseline and differential
GenevisibleiQ6S5L8 HS

Family and domain databases

CDDicd01209 PTB_Shc, 1 hit
cd09925 SH2_SHC, 1 hit
Gene3Di2.30.29.30, 1 hit
3.30.505.10, 1 hit
InterProiView protein in InterPro
IPR011993 PH-like_dom_sf
IPR006019 PID_Shc-like
IPR006020 PTB/PI_dom
IPR000980 SH2
IPR036860 SH2_dom_sf
IPR029596 SHC4
IPR035676 SHC_SH2
PANTHERiPTHR10337:SF12 PTHR10337:SF12, 1 hit
PfamiView protein in Pfam
PF00640 PID, 1 hit
PF00017 SH2, 1 hit
PRINTSiPR00401 SH2DOMAIN
PR00629 SHCPIDOMAIN
SMARTiView protein in SMART
SM00462 PTB, 1 hit
SM00252 SH2, 1 hit
SUPFAMiSSF55550 SSF55550, 1 hit
PROSITEiView protein in PROSITE
PS01179 PID, 1 hit
PS50001 SH2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSHC4_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6S5L8
Secondary accession number(s): Q6UXQ3, Q8IYW3
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: July 5, 2004
Last modified: January 16, 2019
This is version 128 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  2. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again