Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

UNC5C-like protein

Gene

Unc5cl

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Inhibits NF-kappa-B-dependent transcription by impairing NF-kappa-B binding to its targets.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Active sitei227PROSITE-ProRule annotation1
Active sitei229PROSITE-ProRule annotation1

GO - Molecular functioni

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
UNC5C-like protein
Alternative name(s):
Protein unc-5 homolog C-like
ZU5 and death domain-containing protein
Gene namesi
Name:Unc5cl
Synonyms:Zud
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:1923839 Unc5cl

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 10ExtracellularSequence analysis10
Transmembranei11 – 31Helical; Signal-anchor for type III membrane proteinSequence analysisAdd BLAST21
Topological domaini32 – 518CytoplasmicSequence analysisAdd BLAST487

Keywords - Cellular componenti

Cytoplasm, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003095681 – 518UNC5C-like proteinAdd BLAST518

Proteomic databases

PaxDbiQ6R653
PRIDEiQ6R653

PTM databases

PhosphoSitePlusiQ6R653

Expressioni

Gene expression databases

CleanExiMM_UNC5CL

Interactioni

Subunit structurei

Interacts with p65/RELA and NFKB1.By similarity

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000074159

Structurei

3D structure databases

ProteinModelPortaliQ6R653
SMRiQ6R653
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini102 – 237ZU5PROSITE-ProRule annotationAdd BLAST136
Domaini415 – 494DeathPROSITE-ProRule annotationAdd BLAST80

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni186 – 400Interaction with RELA and NFKB1By similarityAdd BLAST215
Regioni208 – 235Peptidase S68PROSITE-ProRule annotationAdd BLAST28

Sequence similaritiesi

Belongs to the unc-5 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1480 Eukaryota
ENOG410XRS6 LUCA
HOVERGENiHBG108649
InParanoidiQ6R653
PhylomeDBiQ6R653

Family and domain databases

InterProiView protein in InterPro
IPR011029 DEATH-like_dom_sf
IPR000488 Death_domain
IPR037936 UNC5
IPR033772 UPA
IPR000906 ZU5_dom
PANTHERiPTHR12582 PTHR12582, 1 hit
PfamiView protein in Pfam
PF00531 Death, 1 hit
PF17217 UPA, 1 hit
PF00791 ZU5, 1 hit
SMARTiView protein in SMART
SM00005 DEATH, 1 hit
SM00218 ZU5, 1 hit
SUPFAMiSSF47986 SSF47986, 1 hit
PROSITEiView protein in PROSITE
PS50017 DEATH_DOMAIN, 1 hit
PS51145 ZU5, 1 hit

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 6 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6R653-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MSPQESSVQP SQFLLLVGIP VASALLLAQC LRWHCCQWLP GTCRKPDDPE
60 70 80 90 100
EPVSPSTPLP EYELPRQCPA PTLPEVAAFY QELHMPTQGQ TVTRQMMHKL
110 120 130 140 150
LVFSAREVDH RGGCLILQDT GISLLIPPGA VTVGRQERVS LVLVWDLTDA
160 170 180 190 200
PSLSHRQGLV SPVVACGPHG ASFLKPCTLT FKHCAQQPSQ ACAYSSNTSL
210 220 230 240 250
LDAKDWKPLG QPGTHISRDE CRILLSHFSL YTCVLEAPLG QTARKWLQLA
260 270 280 290 300
MFCSPLVPGQ THLQLRVYFL NNTPCALQWA ITNEQPHGGR MRGPCQLFDF
310 320 330 340 350
TGARADQCLK LKYISEGWEN VDDSSSQLVP HLHIWHGKCP FRSFCFRRKA
360 370 380 390 400
ANGNEECSAL TNEIIVTMHT FQDGLETKYV EILRFQASEE ETWAVPPPVS
410 420 430 440 450
QPPLCNRLPP ELFEQLQMLL EPNSVTGNDW RRLASHLGLC GMKIRFLSCQ
460 470 480 490 500
RSPAAAILEL FEEQNGSLQE LHYLMTSMER LDCASAIQNY LNRSPRGSPD
510
RLHGGTWENH GLELDEKL
Length:518
Mass (Da):57,956
Last modified:November 13, 2007 - v2
Checksum:i9CDBC91527996C8B
GO
Isoform 2 (identifier: Q6R653-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-342: Missing.
     343-373: SFCFRRKAANGNEECSALTNEIIVTMHTFQD → MWMIAVASWFHISTSGMESAPSVLSASGERQ

Show »
Length:176
Mass (Da):19,840
Checksum:i5A45A1244A23FDE7
GO
Isoform 3 (identifier: Q6R653-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-342: Missing.
     343-373: SFCFRRKAANGNEECSALTNEIIVTMHTFQD → MWMIAVASWFHISTSGMESAPSVLSASGERQ
     446-449: FLSC → DPVD
     450-518: Missing.

Note: No experimental confirmation available.
Show »
Length:107
Mass (Da):11,995
Checksum:i2A54AFEE3827F768
GO
Isoform 4 (identifier: Q6R653-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-354: Missing.
     355-383: EECSALTNEIIVTMHTFQDGLETKYVEIL → MWMIAVASWFHISTSGMESAPSVLSASGE

Note: No experimental confirmation available.
Show »
Length:164
Mass (Da):18,409
Checksum:i815E0DD1DDBA3582
GO

Computationally mapped potential isoform sequencesi

There are 6 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E9QLC2E9QLC2_MOUSE
UNC5C-like protein
Unc5cl
518Annotation score:
F6TRC7F6TRC7_MOUSE
UNC5C-like protein
Unc5cl
110Annotation score:
E0CXQ5E0CXQ5_MOUSE
UNC5C-like protein
Unc5cl
67Annotation score:
F6TUJ1F6TUJ1_MOUSE
UNC5C-like protein
Unc5cl
76Annotation score:
F7CT06F7CT06_MOUSE
UNC5C-like protein
Unc5cl
79Annotation score:
F7BJ90F7BJ90_MOUSE
UNC5C-like protein
Unc5cl
73Annotation score:

Sequence cautioni

The sequence BAE26140 differs from that shown. Reason: Frameshift at position 495.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti46P → L in AAS80164 (PubMed:14769797).Curated1
Sequence conflicti210G → R in AAH95959 (PubMed:16141072).Curated1
Sequence conflicti388S → L in AAH95959 (PubMed:16141072).Curated1
Sequence conflicti446F → V in AAS80164 (PubMed:14769797).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0292351 – 354Missing in isoform 4. 1 PublicationAdd BLAST354
Alternative sequenceiVSP_0292361 – 342Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST342
Alternative sequenceiVSP_029237343 – 373SFCFR…HTFQD → MWMIAVASWFHISTSGMESA PSVLSASGERQ in isoform 2 and isoform 3. 2 PublicationsAdd BLAST31
Alternative sequenceiVSP_029238355 – 383EECSA…YVEIL → MWMIAVASWFHISTSGMESA PSVLSASGE in isoform 4. 1 PublicationAdd BLAST29
Alternative sequenceiVSP_029239446 – 449FLSC → DPVD in isoform 3. 1 Publication4
Alternative sequenceiVSP_029240450 – 518Missing in isoform 3. 1 PublicationAdd BLAST69

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY510108 mRNA Translation: AAS80164.1
AK010945 mRNA Translation: BAC25320.1
AK039924 mRNA Translation: BAC30479.1
AK089034 mRNA Translation: BAC40711.1
AK144925 mRNA Translation: BAE26140.1 Frameshift.
BC022701 mRNA Translation: AAH22701.1
BC095959 mRNA Translation: AAH95959.1
CCDSiCCDS28870.1 [Q6R653-1]
UniGeneiMm.311629

Genome annotation databases

UCSCiuc008cya.1 mouse [Q6R653-2]
uc008cyb.1 mouse [Q6R653-4]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY510108 mRNA Translation: AAS80164.1
AK010945 mRNA Translation: BAC25320.1
AK039924 mRNA Translation: BAC30479.1
AK089034 mRNA Translation: BAC40711.1
AK144925 mRNA Translation: BAE26140.1 Frameshift.
BC022701 mRNA Translation: AAH22701.1
BC095959 mRNA Translation: AAH95959.1
CCDSiCCDS28870.1 [Q6R653-1]
UniGeneiMm.311629

3D structure databases

ProteinModelPortaliQ6R653
SMRiQ6R653
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000074159

PTM databases

PhosphoSitePlusiQ6R653

Proteomic databases

PaxDbiQ6R653
PRIDEiQ6R653

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

UCSCiuc008cya.1 mouse [Q6R653-2]
uc008cyb.1 mouse [Q6R653-4]

Organism-specific databases

MGIiMGI:1923839 Unc5cl

Phylogenomic databases

eggNOGiKOG1480 Eukaryota
ENOG410XRS6 LUCA
HOVERGENiHBG108649
InParanoidiQ6R653
PhylomeDBiQ6R653

Miscellaneous databases

PROiPR:Q6R653
SOURCEiSearch...

Gene expression databases

CleanExiMM_UNC5CL

Family and domain databases

InterProiView protein in InterPro
IPR011029 DEATH-like_dom_sf
IPR000488 Death_domain
IPR037936 UNC5
IPR033772 UPA
IPR000906 ZU5_dom
PANTHERiPTHR12582 PTHR12582, 1 hit
PfamiView protein in Pfam
PF00531 Death, 1 hit
PF17217 UPA, 1 hit
PF00791 ZU5, 1 hit
SMARTiView protein in SMART
SM00005 DEATH, 1 hit
SM00218 ZU5, 1 hit
SUPFAMiSSF47986 SSF47986, 1 hit
PROSITEiView protein in PROSITE
PS50017 DEATH_DOMAIN, 1 hit
PS51145 ZU5, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiUN5CL_MOUSE
AccessioniPrimary (citable) accession number: Q6R653
Secondary accession number(s): Q3UMF8
, Q501N0, Q8BTQ8, Q8BYF7, Q8C1L0, Q8K3C8
Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: November 13, 2007
Last modified: May 23, 2018
This is version 85 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again