Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 135 (13 Feb 2019)
Sequence version 1 (05 Jul 2004)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Adhesion G-protein coupled receptor D1

Gene

ADGRD1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Orphan receptor. Signals via G(s)-alpha family of G-proteins (PubMed:22025619, PubMed:22575658). Has protumorigenic function especially in glioblastoma (PubMed:27775701).3 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • G protein-coupled receptor activity Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionG-protein coupled receptor, Receptor, Transducer

Protein family/group databases

MEROPS protease database

More...
MEROPSi
P02.021

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Adhesion G-protein coupled receptor D11 Publication
Alternative name(s):
G-protein coupled receptor 133
G-protein coupled receptor PGR25
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ADGRD1
Synonyms:GPR133, PGR25
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 12

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000111452.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19893 ADGRD1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
613639 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6QNK2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the subcellular compartment where each non-membrane region of a membrane-spanning protein is found.<p><a href='/help/topo_dom' target='_top'>More...</a></p>Topological domaini26 – 570ExtracellularCuratedAdd BLAST545
<p>This subsection of the <a href="http://www.uniprot.org/help/subcellular_location_section">'Subcellular location'</a> section describes the extent of a membrane-spanning region of the protein. It denotes the presence of both alpha-helical transmembrane regions and the membrane spanning regions of beta-barrel transmembrane proteins.<p><a href='/help/transmem' target='_top'>More...</a></p>Transmembranei571 – 591Helical; Name=1Sequence analysisAdd BLAST21
Topological domaini592 – 602CytoplasmicCuratedAdd BLAST11
Transmembranei603 – 623Helical; Name=2Sequence analysisAdd BLAST21
Topological domaini624 – 633ExtracellularCurated10
Transmembranei634 – 654Helical; Name=3Sequence analysisAdd BLAST21
Topological domaini655 – 674CytoplasmicCuratedAdd BLAST20
Transmembranei675 – 695Helical; Name=4Sequence analysisAdd BLAST21
Topological domaini696 – 711ExtracellularCuratedAdd BLAST16
Transmembranei712 – 732Helical; Name=5Sequence analysisAdd BLAST21
Topological domaini733 – 760CytoplasmicCuratedAdd BLAST28
Transmembranei761 – 781Helical; Name=6Sequence analysisAdd BLAST21
Topological domaini782 – 784ExtracellularCurated3
Transmembranei785 – 805Helical; Name=7Sequence analysisAdd BLAST21
Topological domaini806 – 874CytoplasmicCuratedAdd BLAST69

Keywords - Cellular componenti

Cell membrane, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi543H → R: Does not affect membrane trafficking and basal activity. 1 Publication1
Mutagenesisi545T → A: No effect on G-protein coupled receptor activity; does not affect subcellular location. 1 Publication1
Mutagenesisi550L → A: Abolishes G-protein coupled receptor activity; does not affect subcellular location. 1 Publication1
Mutagenesisi551M → A: Abolishes G-protein coupled receptor activity; does not affect subcellular location. 1 Publication1
Mutagenesisi554V → A: Abolishes G-protein coupled receptor activity; does not affect subcellular location. 1 Publication1
Mutagenesisi808L → T: Does not affect membrane trafficking. Abolishes receptor activity. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
283383

Open Targets

More...
OpenTargetsi
ENSG00000111452

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134923933

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ADGRD1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
59797935

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section denotes the presence of an N-terminal signal peptide.<p><a href='/help/signal' target='_top'>More...</a></p>Signal peptidei1 – 25Sequence analysisAdd BLAST25
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000001290526 – 874Adhesion G-protein coupled receptor D1Add BLAST849

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section specifies the position and type of each covalently attached glycan group (mono-, di-, or polysaccharide).<p><a href='/help/carbohyd' target='_top'>More...</a></p>Glycosylationi90N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi185N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi282N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi302N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi319N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi394N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi476N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi501N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi533N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6QNK2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6QNK2

PeptideAtlas

More...
PeptideAtlasi
Q6QNK2

PRoteomics IDEntifications database

More...
PRIDEi
Q6QNK2

ProteomicsDB human proteome resource

More...
ProteomicsDBi
67303
67304 [Q6QNK2-2]
67305 [Q6QNK2-3]

PTM databases

GlyConnect protein glycosylation platform

More...
GlyConnecti
1913

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6QNK2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6QNK2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Up-regulated in CD133+ cell population of glioblastoma.1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated by hypoxia in hypoxia-inducible factor 1-alpha (HIF1A)-dependent manner.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000111452 Expressed in 151 organ(s), highest expression level in right atrium auricular region

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6QNK2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6QNK2 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA042395

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
129544, 1 interactor

Protein interaction database and analysis system

More...
IntActi
Q6QNK2, 1 interactor

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000261654

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q6QNK2

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini79 – 276Pentraxin (PTX)PROSITE-ProRule annotationAdd BLAST198
Domaini507 – 556GPSPROSITE-ProRule annotationAdd BLAST50

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes a short (usually not more than 20 amino acids) conserved sequence motif of biological significance.<p><a href='/help/motif' target='_top'>More...</a></p>Motifi546 – 554Stachel1 Publication9

<p>This subsection of the ‘Family and domains’ section provides general information on the biological role of a domain. The term ‘domain’ is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

A short peptide sequence (termed the Stachel sequence) in the C-terminal part of the extracellular domain (ECD) functions as a tethered agonist. Upon structural changes within the ECD, e.g. due to extracellular ligand binding or mechanical movements, this intramolecular agonist is exposed to the 7 transmembrane region, triggering G-protein activation.1 Publication
The N-terminal domain and autocatalytic activity of ADGRD1 at the GPCR proteolysis site (GPS) are not required for G-protein coupling activity.1 Publication

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4193 Eukaryota
ENOG410XSD2 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000159783

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000056451

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG051779

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6QNK2

KEGG Orthology (KO)

More...
KOi
K08465

Database of Orthologous Groups

More...
OrthoDBi
388923at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6QNK2

TreeFam database of animal gene trees

More...
TreeFami
TF351999

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR013320 ConA-like_dom_sf
IPR017981 GPCR_2-like
IPR000832 GPCR_2_secretin-like
IPR017983 GPCR_2_secretin-like_CS
IPR000203 GPS
IPR001759 Pentraxin-related

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00002 7tm_2, 1 hit
PF01825 GPS, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00249 GPCRSECRETIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00303 GPS, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49899 SSF49899, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00650 G_PROTEIN_RECEP_F2_2, 1 hit
PS50261 G_PROTEIN_RECEP_F2_4, 1 hit
PS50221 GPS, 1 hit
PS51828 PTX_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6QNK2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MEKLLRLCCW YSWLLLFYYN FQVRGVYSRS QDHPGFQVLA SASHYWPLEN
60 70 80 90 100
VDGIHELQDT TGDIVEGKVN KGIYLKEEKG VTLLYYGRYN SSCISKPEQC
110 120 130 140 150
GPEGVTFSFF WKTQGEQSRP IPSAYGGQVI SNGFKVCSSG GRGSVELYTR
160 170 180 190 200
DNSMTWEASF SPPGPYWTHV LFTWKSKEGL KVYVNGTLST SDPSGKVSRD
210 220 230 240 250
YGESNVNLVI GSEQDQAKCY ENGAFDEFII WERALTPDEI AMYFTAAIGK
260 270 280 290 300
HALLSSTLPS LFMTSTASPV MPTDAYHPII TNLTEERKTF QSPGVILSYL
310 320 330 340 350
QNVSLSLPSK SLSEQTALNL TKTFLKAVGE ILLLPGWIAL SEDSAVVLSL
360 370 380 390 400
IDTIDTVMGH VSSNLHGSTP QVTVEGSSAM AEFSVAKILP KTVNSSHYRF
410 420 430 440 450
PAHGQSFIQI PHEAFHRHAW STVVGLLYHS MHYYLNNIWP AHTKIAEAMH
460 470 480 490 500
HQDCLLFATS HLISLEVSPP PTLSQNLSGS PLITVHLKHR LTRKQHSEAT
510 520 530 540 550
NSSNRVFVYC AFLDFSSGEG VWSNHGCALT RGNLTYSVCR CTHLTNFAIL
560 570 580 590 600
MQVVPLELAR GHQVALSSIS YVGCSLSVLC LVATLVTFAV LSSVSTIRNQ
610 620 630 640 650
RYHIHANLSF AVLVAQVLLL ISFRLEPGTT PCQVMAVLLH YFFLSAFAWM
660 670 680 690 700
LVEGLHLYSM VIKVFGSEDS KHRYYYGMGW GFPLLICIIS LSFAMDSYGT
710 720 730 740 750
SNNCWLSLAS GAIWAFVAPA LFVIVVNIGI LIAVTRVISQ ISADNYKIHG
760 770 780 790 800
DPSAFKLTAK AVAVLLPILG TSWVFGVLAV NGCAVVFQYM FATLNSLQGL
810 820 830 840 850
FIFLFHCLLN SEVRAAFKHK TKVWSLTSSS ARTSNAKPFH SDLMNGTRPG
860 870
MASTKLSPWD KSSHSAHRVD LSAV
Length:874
Mass (Da):96,530
Last modified:July 5, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i8FC7C63D50F65E1B
GO
Isoform 2 (identifier: Q6QNK2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-314: Missing.
     315-341: QTALNLTKTFLKAVGEILLLPGWIALS → MEKGTELLVSPSQSGPGGDQPLLVKHR

Note: No experimental confirmation available.
Show »
Length:560
Mass (Da):61,360
Checksum:i3191A83261A5078D
GO
Isoform 3 (identifier: Q6QNK2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-481: Missing.
     482-491: LITVHLKHRL → MHRVCFLSFQ

Note: No experimental confirmation available.
Show »
Length:393
Mass (Da):43,210
Checksum:iD108A3060EA93E60
GO
Isoform 4 (identifier: Q6QNK2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     62-62: G → GASRTHKLTVLPSRNATFVYSNDSAYSNLSATV

Note: No experimental confirmation available.
Show »
Length:906
Mass (Da):99,984
Checksum:i1C8D7423F602F3E8
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H0Y2U9H0Y2U9_HUMAN
Adhesion G-protein-coupled receptor...
ADGRD1
156Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A087WYZ5A0A087WYZ5_HUMAN
Adhesion G-protein-coupled receptor...
ADGRD1
345Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H7I3F5H7I3_HUMAN
Adhesion G-protein-coupled receptor...
ADGRD1
220Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti703N → S in AAP35063 (PubMed:15203201).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_07769818Y → C Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs149181066Ensembl.1
Natural variantiVAR_07769918Y → H Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs146611221Ensembl.1
Natural variantiVAR_07770032D → N Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs376178471Ensembl.1
Natural variantiVAR_07770178E → K Polymorphism; does not affect subcellular location; increases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs267603378Ensembl.1
Natural variantiVAR_07770282T → M Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs143395855Ensembl.1
Natural variantiVAR_07770385Y → C Polymorphism; does not affect subcellular location; decreases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs199848650Ensembl.1
Natural variantiVAR_07770489Y → D Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs201546462Ensembl.1
Natural variantiVAR_077705110F → L Polymorphism; reduces cell membrane location; decreases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs148928637Ensembl.1
Natural variantiVAR_077706138S → F Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs199526762Ensembl.1
Natural variantiVAR_077707140G → S Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs374985420Ensembl.1
Natural variantiVAR_077708141G → D Polymorphism; does not affect subcellular location; increases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs142759046Ensembl.1
Natural variantiVAR_077709145V → L Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs146945782Ensembl.1
Natural variantiVAR_077710150R → W Polymorphism; does not affect subcellular location; decreases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs144030317Ensembl.1
Natural variantiVAR_077711174W → S Polymorphism; reduces cell membrane location; decreases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs141606054Ensembl.1
Natural variantiVAR_077712178E → K Polymorphism; reduces cell membrane location; decreases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs148148477Ensembl.1
Natural variantiVAR_077713184V → I Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs61732860Ensembl.1
Natural variantiVAR_077714195G → R Polymorphism; reduces cell membrane location; decreases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs267603379Ensembl.1
Natural variantiVAR_077715199R → C Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs146310036Ensembl.1
Natural variantiVAR_077716199R → H Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs375084180Ensembl.1
Natural variantiVAR_077717203E → D Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs201045213Ensembl.1
Natural variantiVAR_077718209V → M Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs139478688Ensembl.1
Natural variantiVAR_077719226D → N Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs377562590Ensembl.1
Natural variantiVAR_077720233R → W Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs370807516Ensembl.1
Natural variantiVAR_077721241A → T Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs368468703Ensembl.1
Natural variantiVAR_077722242M → T Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs201057341Ensembl.1
Natural variantiVAR_077723245T → I Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs201053759Ensembl.1
Natural variantiVAR_077724257T → A Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs146563785Ensembl.1
Natural variantiVAR_077725259P → Q Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs75096240Ensembl.1
Natural variantiVAR_077726265S → Y Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs137909892Ensembl.1
Natural variantiVAR_077727268S → N Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs149012578Ensembl.1
Natural variantiVAR_077728270V → A Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs147773154Ensembl.1
Natural variantiVAR_077729270V → M Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs147105264Ensembl.1
Natural variantiVAR_077730293P → A Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs146929634Ensembl.1
Natural variantiVAR_077731294G → R Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs148017957Ensembl.1
Natural variantiVAR_077732308P → S Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs201661954Ensembl.1
Natural variantiVAR_077733318L → F Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs200641036Ensembl.1
Natural variantiVAR_077734349S → N Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs370854685Ensembl.1
Natural variantiVAR_077735364N → S Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs146050435Ensembl.1
Natural variantiVAR_077736369T → M Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs142314859Ensembl.1
Natural variantiVAR_077737383F → S Polymorphism; does not affect subcellular location; increases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs200232576Ensembl.1
Natural variantiVAR_077738393V → M Polymorphism; does not affect subcellular location; increases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs374606811Ensembl.1
Natural variantiVAR_077739397H → Q Polymorphism; does not affect subcellular location. 1 PublicationCorresponds to variant dbSNP:rs201985264Ensembl.1
Natural variantiVAR_077740399R → C Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs150882180Ensembl.1
Natural variantiVAR_077741404G → A Polymorphism; does not affect subcellular location; increases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs371536090Ensembl.1
Natural variantiVAR_077742405Q → P Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs145663007Ensembl.1
Natural variantiVAR_077743410I → V Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs376489706Ensembl.1
Natural variantiVAR_077744411P → S Polymorphism; does not affect subcellular location; increases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs147757048Ensembl.1
Natural variantiVAR_077745413E → K Polymorphism; does not affect subcellular location; increases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs142628291Ensembl.1
Natural variantiVAR_077746419A → V Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs370959644Ensembl.1
Natural variantiVAR_077747425G → S Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs374575404Ensembl.1
Natural variantiVAR_077748441A → T Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs375271891Ensembl.1
Natural variantiVAR_077749448A → D Polymorphism; reduces cell membrane location; decreases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs200173874Ensembl.1
Natural variantiVAR_077750450H → R Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs200060202Ensembl.1
Natural variantiVAR_077751453D → N Polymorphism; does not affect subcellular location; increases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs149065791Ensembl.1
Natural variantiVAR_077752454C → Y Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs143062748Ensembl.1
Natural variantiVAR_077753458A → T Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs140426880Ensembl.1
Natural variantiVAR_077754464S → A Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs78638447Ensembl.1
Natural variantiVAR_077755476N → S Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs138163855Ensembl.1
Natural variantiVAR_077756478S → L Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs372643228Ensembl.1
Natural variantiVAR_077757484T → M Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs149266247Ensembl.1
Natural variantiVAR_077758485V → I Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs369012277Ensembl.1
Natural variantiVAR_077759498E → G Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs200576124Ensembl.1
Natural variantiVAR_077760499A → S Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs150620459Ensembl.1
Natural variantiVAR_049461508V → M Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs11833801Ensembl.1
Natural variantiVAR_049462523S → L Polymorphism; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs11061318Ensembl.1
Natural variantiVAR_077761524N → K Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs370443698Ensembl.1
Natural variantiVAR_077762538V → A Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs201849687Ensembl.1
Natural variantiVAR_077763538V → I Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs200971352Ensembl.1
Natural variantiVAR_077764540R → C Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs147294464Ensembl.1
Natural variantiVAR_077765540R → H Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs145630930Ensembl.1
Natural variantiVAR_077766560R → C Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs371989819Ensembl.1
Natural variantiVAR_077767560R → H Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs375179921Ensembl.1
Natural variantiVAR_077768567S → L Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs192515185Ensembl.1
Natural variantiVAR_077769569I → V Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs139017446Ensembl.1
Natural variantiVAR_077770589A → T Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs201161291Ensembl.1
Natural variantiVAR_077771594V → M Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs189007948Ensembl.1
Natural variantiVAR_077772601R → H Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs201524753Ensembl.1
Natural variantiVAR_077773608L → M Polymorphism; does not affect subcellular location; decreases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs200052797Ensembl.1
Natural variantiVAR_077774624R → C Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs117457351Ensembl.1
Natural variantiVAR_077775626E → K Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs199778477Ensembl.1
Natural variantiVAR_077776630T → I Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs145482553Ensembl.1
Natural variantiVAR_077777667S → L Polymorphism; does not affect subcellular location; decreases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs377401276Ensembl.1
Natural variantiVAR_077778673R → H Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs141128784Ensembl.1
Natural variantiVAR_077779695M → T Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs143163307Ensembl.1
Natural variantiVAR_077780699G → V Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 Publication1
Natural variantiVAR_077781720A → V Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs141439159Ensembl.1
Natural variantiVAR_077782743A → T Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs143902981Ensembl.1
Natural variantiVAR_077783749H → R Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs372207677Ensembl.1
Natural variantiVAR_077784751D → E Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs147763331Ensembl.1
Natural variantiVAR_077785761A → E Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs369201469Ensembl.1
Natural variantiVAR_077786764V → M Polymorphism; reduces cell membrane location; decreases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs149434203Ensembl.1
Natural variantiVAR_077787777V → M Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs144814859Ensembl.1
Natural variantiVAR_077788779A → V Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs61746588Ensembl.1
Natural variantiVAR_077789793T → M Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs375488636Ensembl.1
Natural variantiVAR_077790795N → K Polymorphism; decreases cell surface location; abolishes G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs369853823Ensembl.1
Natural variantiVAR_077791816A → T Polymorphism; reduces cell membrane location; decreases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs368828722Ensembl.1
Natural variantiVAR_077792827T → M Polymorphism; does not affect subcellular location; increases G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs371135988Ensembl.1
Natural variantiVAR_077793831A → T Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs146661482Ensembl.1
Natural variantiVAR_077794836A → T Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs144023497Ensembl.1
Natural variantiVAR_077795836A → V Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs367789023Ensembl.1
Natural variantiVAR_077796851M → T Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs78058857Ensembl.1
Natural variantiVAR_077797868R → H Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs61740366Ensembl.1
Natural variantiVAR_077798869V → I Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs377434309Ensembl.1
Natural variantiVAR_077799870D → N Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs143670024Ensembl.1
Natural variantiVAR_077800874V → M Polymorphism; does not affect subcellular location; does not change G-protein coupled receptor activity. 1 PublicationCorresponds to variant dbSNP:rs148442158Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0127871 – 481Missing in isoform 3. 1 PublicationAdd BLAST481
Alternative sequenceiVSP_0127881 – 314Missing in isoform 2. 1 PublicationAdd BLAST314
Alternative sequenceiVSP_05367862G → GASRTHKLTVLPSRNATFVY SNDSAYSNLSATV in isoform 4. 1 Publication1
Alternative sequenceiVSP_012789315 – 341QTALN…WIALS → MEKGTELLVSPSQSGPGGDQ PLLVKHR in isoform 2. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_012790482 – 491LITVHLKHRL → MHRVCFLSFQ in isoform 3. 1 Publication10

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY532280 mRNA Translation: AAS37682.1
AY278561 mRNA Translation: AAP35063.1
EU523118 mRNA Translation: ACB20802.1
AK131538 mRNA Translation: BAD18674.1
AC073862 Genomic DNA No translation available.
AC078925 Genomic DNA No translation available.
AC126564 Genomic DNA No translation available.
BC112307 mRNA Translation: AAI12308.1
BC112309 mRNA Translation: AAI12310.1
BC143775 mRNA Translation: AAI43776.1
AY255587 mRNA Translation: AAO85099.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS81753.1 [Q6QNK2-4]
CCDS9272.1 [Q6QNK2-1]

Protein sequence database of the Protein Information Resource

More...
PIRi
T47186

NCBI Reference Sequences

More...
RefSeqi
NP_001317426.1, NM_001330497.1 [Q6QNK2-4]
NP_942122.2, NM_198827.4 [Q6QNK2-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.719239

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000261654; ENSP00000261654; ENSG00000111452 [Q6QNK2-1]
ENST00000535015; ENSP00000444425; ENSG00000111452 [Q6QNK2-4]
ENST00000543617; ENSP00000438021; ENSG00000111452 [Q6QNK2-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
283383

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:283383

UCSC genome browser

More...
UCSCi
uc001uit.5 human [Q6QNK2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY532280 mRNA Translation: AAS37682.1
AY278561 mRNA Translation: AAP35063.1
EU523118 mRNA Translation: ACB20802.1
AK131538 mRNA Translation: BAD18674.1
AC073862 Genomic DNA No translation available.
AC078925 Genomic DNA No translation available.
AC126564 Genomic DNA No translation available.
BC112307 mRNA Translation: AAI12308.1
BC112309 mRNA Translation: AAI12310.1
BC143775 mRNA Translation: AAI43776.1
AY255587 mRNA Translation: AAO85099.1
CCDSiCCDS81753.1 [Q6QNK2-4]
CCDS9272.1 [Q6QNK2-1]
PIRiT47186
RefSeqiNP_001317426.1, NM_001330497.1 [Q6QNK2-4]
NP_942122.2, NM_198827.4 [Q6QNK2-1]
UniGeneiHs.719239

3D structure databases

ProteinModelPortaliQ6QNK2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi129544, 1 interactor
IntActiQ6QNK2, 1 interactor
STRINGi9606.ENSP00000261654

Protein family/group databases

MEROPSiP02.021

Information system for G protein-coupled receptors (GPCRs)

More...
GPCRDBi
Search...

PTM databases

GlyConnecti1913
iPTMnetiQ6QNK2
PhosphoSitePlusiQ6QNK2

Polymorphism and mutation databases

BioMutaiADGRD1
DMDMi59797935

Proteomic databases

jPOSTiQ6QNK2
PaxDbiQ6QNK2
PeptideAtlasiQ6QNK2
PRIDEiQ6QNK2
ProteomicsDBi67303
67304 [Q6QNK2-2]
67305 [Q6QNK2-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
283383
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000261654; ENSP00000261654; ENSG00000111452 [Q6QNK2-1]
ENST00000535015; ENSP00000444425; ENSG00000111452 [Q6QNK2-4]
ENST00000543617; ENSP00000438021; ENSG00000111452 [Q6QNK2-3]
GeneIDi283383
KEGGihsa:283383
UCSCiuc001uit.5 human [Q6QNK2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
283383
DisGeNETi283383
EuPathDBiHostDB:ENSG00000111452.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ADGRD1
HGNCiHGNC:19893 ADGRD1
HPAiHPA042395
MIMi613639 gene
neXtProtiNX_Q6QNK2
OpenTargetsiENSG00000111452
PharmGKBiPA134923933

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG4193 Eukaryota
ENOG410XSD2 LUCA
GeneTreeiENSGT00940000159783
HOGENOMiHOG000056451
HOVERGENiHBG051779
InParanoidiQ6QNK2
KOiK08465
OrthoDBi388923at2759
PhylomeDBiQ6QNK2
TreeFamiTF351999

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ADGRD1 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
283383

Protein Ontology

More...
PROi
PR:Q6QNK2

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000111452 Expressed in 151 organ(s), highest expression level in right atrium auricular region
ExpressionAtlasiQ6QNK2 baseline and differential
GenevisibleiQ6QNK2 HS

Family and domain databases

InterProiView protein in InterPro
IPR013320 ConA-like_dom_sf
IPR017981 GPCR_2-like
IPR000832 GPCR_2_secretin-like
IPR017983 GPCR_2_secretin-like_CS
IPR000203 GPS
IPR001759 Pentraxin-related
PfamiView protein in Pfam
PF00002 7tm_2, 1 hit
PF01825 GPS, 1 hit
PRINTSiPR00249 GPCRSECRETIN
SMARTiView protein in SMART
SM00303 GPS, 1 hit
SUPFAMiSSF49899 SSF49899, 1 hit
PROSITEiView protein in PROSITE
PS00650 G_PROTEIN_RECEP_F2_2, 1 hit
PS50261 G_PROTEIN_RECEP_F2_4, 1 hit
PS50221 GPS, 1 hit
PS51828 PTX_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiAGRD1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6QNK2
Secondary accession number(s): B2CKK9
, B7ZLF7, Q2M1L3, Q6ZMQ1, Q7Z7M2, Q86SM4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 15, 2005
Last sequence update: July 5, 2004
Last modified: February 13, 2019
This is version 135 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  3. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  5. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  6. 7-transmembrane G-linked receptors
    List of 7-transmembrane G-linked receptor entries
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again