Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Calcium-activated chloride channel regulator 4A

Gene

Clca4a

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

May be involved in mediating calcium-activated chloride conductance.2 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi156Zinc; catalyticBy similarity1
Active sitei157By similarity1
Metal bindingi160Zinc; catalyticBy similarity1
Metal bindingi167Zinc; catalyticBy similarity1

GO - Molecular functioni

  • chloride channel activity Source: MGI
  • intracellular calcium activated chloride channel activity Source: GO_Central
  • ligand-gated ion channel activity Source: MGI
  • metal ion binding Source: UniProtKB-KW
  • metallopeptidase activity Source: UniProtKB-KW

GO - Biological processi

Keywordsi

Molecular functionHydrolase, Metalloprotease, Protease
Biological processTransport
LigandChloride, Metal-binding, Zinc

Protein family/group databases

MEROPSiM87.004

Names & Taxonomyi

Protein namesi
Recommended name:
Calcium-activated chloride channel regulator 4AImported (EC:3.4.-.-By similarity)
Alternative name(s):
Calcium-activated chloride channel regulator 6
Short name:
mClca6
Cleaved into the following 2 chains:
Gene namesi
Name:Clca4aImported
Synonyms:Clca6Imported
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Unplaced

Organism-specific databases

MGIiMGI:2139744 Clca4a

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei884 – 904HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Cell membrane, Membrane, Secreted

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_0000345394? – 924Calcium-activated chloride channel regulator 4A, 30 kDa formCurated
Signal peptidei1 – 22Sequence analysisAdd BLAST22
ChainiPRO_000034539223 – 924Calcium-activated chloride channel regulator 4ACuratedAdd BLAST902
ChainiPRO_000034539323 – ?Calcium-activated chloride channel regulator 4A, 110 kDa formCurated

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi76N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi214N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi284N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi341N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi449N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi499N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi505N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi543N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi589N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi730N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi833N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi838N-linked (GlcNAc...) asparagineSequence analysis1

Post-translational modificationi

N-Glycosylated.2 Publications
The translation product is autoproteolytically cleaved by the metalloprotease domain in the endoplasmic reticulum into a N-terminal and a C-terminal products that remain physically associated with each other. The cleavage is necessary for calcium-activated chloride channel (CaCC) activation activity.By similarity

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sitei698 – 699Cleavage; by autolysisBy similarity2

Keywords - PTMi

Autocatalytic cleavage, Glycoprotein

Proteomic databases

PaxDbiQ6Q473
PRIDEiQ6Q473

PTM databases

iPTMnetiQ6Q473
PhosphoSitePlusiQ6Q473

Expressioni

Tissue specificityi

Expressed in the non-goblet intestinal cells. High levels in intestine and stomach, and lower levels in eye, liver and spleen. Increasing expression from the duodenum to the ilium, and decreasing expression to the colon. Isoform 2 is expressed in intestine and stomach but at lower levels than isoform 1.2 Publications

Interactioni

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000029923

Structurei

3D structure databases

ProteinModelPortaliQ6Q473
SMRiQ6Q473
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini307 – 477VWFAPROSITE-ProRule annotationAdd BLAST171

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni46 – 200Metalloprotease domainBy similarityAdd BLAST155

Domaini

The metalloprotease region is responsible for autoproteolytic processing. It can also cross-cleave other CLCA substrates.By similarity

Sequence similaritiesi

Belongs to the CLCR family.Curated

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IEPS Eukaryota
ENOG410XPSZ LUCA
HOGENOMiHOG000015107
HOVERGENiHBG005560
InParanoidiQ6Q473
PhylomeDBiQ6Q473

Family and domain databases

Gene3Di2.60.40.10, 1 hit
3.40.50.410, 1 hit
InterProiView protein in InterPro
IPR004727 CLCA_chordata
IPR013642 CLCA_N
IPR013783 Ig-like_fold
IPR002035 VWF_A
IPR036465 vWFA_dom_sf
PfamiView protein in Pfam
PF08434 CLCA, 1 hit
PF00092 VWA, 1 hit
SMARTiView protein in SMART
SM00327 VWA, 1 hit
SUPFAMiSSF53300 SSF53300, 1 hit
TIGRFAMsiTIGR00868 hCaCC, 1 hit
PROSITEiView protein in PROSITE
PS50234 VWFA, 1 hit

Sequences (2+)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 1 potential isoform that is computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6Q473-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAFSRGPVFL LLLLYLLWGS DTSLIRLNEN GYEDIIIAID PAVPEDTTII
60 70 80 90 100
EHIKGMVTKA STYLFEATEK RFFFKNVSIL IPESWKDSPQ YRRPKQESYK
110 120 130 140 150
HADIKVAPPT VEGRDEPYTR QFTQCEEKAE YIHFTPDFVL GRKQDEYGDS
160 170 180 190 200
GKVLVHEWAH LRWGVFDEYN EDQPFYSASS KKIEATRCST GITGTNRVYA
210 220 230 240 250
CQGGSCAMRR CRTNSTTKLY EKDCQFFPDK VQSEKASIMF MQSIDSVTEF
260 270 280 290 300
CKKENHNREA PTLHNKKCNY RSTWEVISTS EDFNSSTPME TSPSPPFFSL
310 320 330 340 350
LRISERIMCL VLDVSGSMTS YDRLNRMNQA AKYFLSQIIE NRSWVGMVHF
360 370 380 390 400
SSQATIVHEL IQINSDIERN QLLQTLPTSA NGGTSICSGI KAAFQVFKNG
410 420 430 440 450
EYQTDGTEIL LLSDGEDSTA KDCIDEVKDS GSIVHFIALG PLADLAVTNM
460 470 480 490 500
SILTGGNHKL ATDEAQNNGL IDAFGALASE NADITQKSLQ LESKGAILNN
510 520 530 540 550
SLWLNDTVVI DSTLGRDTFF LVTWSKQAPA IYLRDPKGTQ TTNFTMDSAS
560 570 580 590 600
KMAYLSIPGT AQVGVWTYNL EAKENSEILT ITVTSRAANS SVPPITVNAK
610 620 630 640 650
VNTDTNTFPS PMIVYAEVLQ GYTPIIGARV TATIESNSGK TEELVLLDNG
660 670 680 690 700
AGADAFKDDG VYSRFFTAYS VNGRYSLKVR ADGGRNSARR SLRHPSSRAA
710 720 730 740 750
YIPGWVVDGE IQGNPPRPET TEATQPVLEN FSRTASGGAF VVSNVPSGPL
760 770 780 790 800
PDLYPPNQIT DLQATLDGEE ISLTWTAPGD DYDVGRVQQY IIRTSKNIIE
810 820 830 840 850
LRDNFNNSPR VDTTNLTPKE ANSEETFAFK PENITEENAT YIFIAIESVD
860 870 880 890 900
KSSLSSGPSN IAQVALFTPQ AEPDPDESPS SSGVSVATIV LSVLGALVLV
910 920
CIIVGTTICI LKNKRSSSAA ITKF
Length:924
Mass (Da):101,872
Last modified:September 13, 2004 - v2
Checksum:iD1E45A374F1FD897
GO
Isoform 2 (identifier: Q6Q473-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     397-430: FKNGEYQTDGTEILLLSDGEDSTAKDCIDEVKDS → ETISLLQMKPRTMDSLMLSGPWLQKMLISPRSHF
     431-511: Missing.

Show »
Length:843
Mass (Da):93,682
Checksum:i73116D50CBFF034E
GO

Computationally mapped potential isoform sequencesi

There is 1 potential isoform mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
G3X8Z1G3X8Z1_MOUSE
Calcium-activated chloride channel ...
Clca4a Clca6, mCG_119588
925Annotation score:

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_034942397 – 430FKNGE…EVKDS → ETISLLQMKPRTMDSLMLSG PWLQKMLISPRSHF in isoform 2. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_034943431 – 511Missing in isoform 2. 1 PublicationAdd BLAST81

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY560902 mRNA Translation: AAS86332.2
AY560903 mRNA Translation: AAS86333.2
UniGeneiMm.442050

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY560902 mRNA Translation: AAS86332.2
AY560903 mRNA Translation: AAS86333.2
UniGeneiMm.442050

3D structure databases

ProteinModelPortaliQ6Q473
SMRiQ6Q473
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi10090.ENSMUSP00000029923

Protein family/group databases

MEROPSiM87.004

PTM databases

iPTMnetiQ6Q473
PhosphoSitePlusiQ6Q473

Proteomic databases

PaxDbiQ6Q473
PRIDEiQ6Q473

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Organism-specific databases

MGIiMGI:2139744 Clca4a

Phylogenomic databases

eggNOGiENOG410IEPS Eukaryota
ENOG410XPSZ LUCA
HOGENOMiHOG000015107
HOVERGENiHBG005560
InParanoidiQ6Q473
PhylomeDBiQ6Q473

Miscellaneous databases

PROiPR:Q6Q473
SOURCEiSearch...

Family and domain databases

Gene3Di2.60.40.10, 1 hit
3.40.50.410, 1 hit
InterProiView protein in InterPro
IPR004727 CLCA_chordata
IPR013642 CLCA_N
IPR013783 Ig-like_fold
IPR002035 VWF_A
IPR036465 vWFA_dom_sf
PfamiView protein in Pfam
PF08434 CLCA, 1 hit
PF00092 VWA, 1 hit
SMARTiView protein in SMART
SM00327 VWA, 1 hit
SUPFAMiSSF53300 SSF53300, 1 hit
TIGRFAMsiTIGR00868 hCaCC, 1 hit
PROSITEiView protein in PROSITE
PS50234 VWFA, 1 hit
ProtoNetiSearch...

Entry informationi

Entry nameiCLA4A_MOUSE
AccessioniPrimary (citable) accession number: Q6Q473
Secondary accession number(s): Q6Q472
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 22, 2008
Last sequence update: September 13, 2004
Last modified: February 28, 2018
This is version 92 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again