Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

ATPase family AAA domain-containing protein 2

Gene

ATAD2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

May be a transcriptional coactivator of the nuclear receptor ESR1 required to induce the expression of a subset of estradiol target genes, such as CCND1, MYC and E2F1. May play a role in the recruitment or occupancy of CREBBP at some ESR1 target gene promoters. May be required for histone hyperacetylation. Involved in the estrogen-induced cell proliferation and cell cycle progression of breast cancer cells.1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi467 – 474ATPSequence analysis8

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • ATPase activity Source: UniProtKB
  • ATP binding Source: UniProtKB-KW
  • chromatin binding Source: GO_Central
  • histone binding Source: GO_Central

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionActivator, Hydrolase
Biological processTranscription, Transcription regulation
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-8866910 TFAP2 (AP-2) family regulates transcription of growth factors and their receptors

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
ATPase family AAA domain-containing protein 2 (EC:3.6.1.3)
Alternative name(s):
AAA nuclear coregulator cancer-associated protein
Short name:
ANCCA
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ATAD2
ORF Names:L16, PRO2000
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 8

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000156802.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:30123 ATAD2

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
611941 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6PL18

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi473K → T: Reduces the ability to mediate estradiol-dependent induction of CCND1 and E2F1; when associated with Q-532. 1 Publication1
Mutagenesisi532E → Q: Reduces the ability to mediate estradiol-dependent induction of CCND1 and E2F1; when associated with T-473. 1 Publication1

Organism-specific databases

DisGeNET

More...
DisGeNETi
29028

Open Targets

More...
OpenTargetsi
ENSG00000156802

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134895566

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL2150837

IUPHAR/BPS Guide to PHARMACOLOGY

More...
GuidetoPHARMACOLOGYi
2719

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ATAD2

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74762365

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000847961 – 1390ATPase family AAA domain-containing protein 2Add BLAST1390

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei60PhosphoserineCombined sources1
Modified residuei61PhosphoserineCombined sources1
<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM / Processing</a> section describes <strong>covalent linkages</strong> of various types formed <strong>between two proteins (interchain cross-links)</strong> or <strong>between two parts of the same protein (intrachain cross-links)</strong>, except the disulfide bonds that are annotated in the <a href="http://www.uniprot.org/manual/disulfid">'Disulfide bond'</a> subsection.<p><a href='/help/crosslnk' target='_top'>More...</a></p>Cross-linki125Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei165PhosphoserineCombined sources1
Modified residuei170PhosphoserineCombined sources1
Cross-linki317Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei327PhosphoserineCombined sources1
Modified residuei337PhosphoserineCombined sources1
Modified residuei342PhosphoserineCombined sources1
Modified residuei410PhosphoserineCombined sources1
Modified residuei746PhosphoserineCombined sources1
Modified residuei751PhosphoserineCombined sources1
Cross-linki1128Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei1139PhosphoserineCombined sources1
Cross-linki1148Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei1149PhosphothreonineCombined sources1
Modified residuei1152PhosphothreonineCombined sources1
Modified residuei1176PhosphothreonineCombined sources1
Modified residuei1200PhosphoserineCombined sources1
Modified residuei1233PhosphoserineCombined sources1
Modified residuei1235PhosphoserineCombined sources1
Cross-linki1236Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO2)Combined sources
Modified residuei1243PhosphoserineCombined sources1
Modified residuei1302PhosphoserineCombined sources1
Modified residuei1323PhosphothreonineCombined sources1

Keywords - PTMi

Isopeptide bond, Phosphoprotein, Ubl conjugation

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q6PL18

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q6PL18

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6PL18

PeptideAtlas

More...
PeptideAtlasi
Q6PL18

PRoteomics IDEntifications database

More...
PRIDEi
Q6PL18

ProteomicsDB human proteome resource

More...
ProteomicsDBi
67248
67249 [Q6PL18-2]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6PL18

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6PL18

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Highly expressed in estrogen receptor positive breast tumors and in osteosarcoma tumors.3 Publications

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated in breast, uterus, colon, ovary, and stomach tumors. Induced in breast cancer cells overexpressing NCOA3 or treated with estrogen. Down-regulated in 5-fluorouracil-resistant derivatives of the colon cancer cell line HCT 116.3 Publications

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000156802 Expressed in 174 organ(s), highest expression level in secondary oocyte

CleanEx database of gene expression profiles

More...
CleanExi
HS_ATAD2

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6PL18 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6PL18 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
CAB056158
HPA029424

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with ESR1 and NCOA3 and these interactions are enhanced by estradiol. Interacts with acetylated lysine residues on histone H1.4, H2A, H2B and H3 (in vitro).2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
118827, 23 interactors

Database of interacting proteins

More...
DIPi
DIP-46197N

Protein interaction database and analysis system

More...
IntActi
Q6PL18, 9 interactors

Molecular INTeraction database

More...
MINTi
Q6PL18

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000287394

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q6PL18

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

11390
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q6PL18

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6PL18

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

Miscellaneous databases

Relative evolutionary importance of amino acids within a protein sequence

More...
EvolutionaryTracei
Q6PL18

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1001 – 1071BromoPROSITE-ProRule annotationAdd BLAST71

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili970 – 994Sequence analysisAdd BLAST25
Coiled coili1086 – 1112Sequence analysisAdd BLAST27

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi250 – 285Asp-richAdd BLAST36
Compositional biasi357 – 366Poly-Ser10

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the AAA ATPase family.Curated

Keywords - Domaini

Bromodomain, Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0732 Eukaryota
COG0464 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00550000074694

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG080873

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6PL18

KEGG Orthology (KO)

More...
KOi
K22531

Identification of Orthologs from Complete Genome Data

More...
OMAi
KSKWYLG

Database of Orthologous Groups

More...
OrthoDBi
EOG091G0152

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6PL18

TreeFam database of animal gene trees

More...
TreeFami
TF314783

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.20.920.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR003593 AAA+_ATPase
IPR031252 ANCCA
IPR003959 ATPase_AAA_core
IPR003960 ATPase_AAA_CS
IPR001487 Bromodomain
IPR036427 Bromodomain-like_sf
IPR027417 P-loop_NTPase

The PANTHER Classification System

More...
PANTHERi
PTHR23069:SF4 PTHR23069:SF4, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF00004 AAA, 1 hit
PF00439 Bromodomain, 1 hit

Protein Motif fingerprint database; a protein domain database

More...
PRINTSi
PR00503 BROMODOMAIN

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00382 AAA, 1 hit
SM00297 BROMO, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47370 SSF47370, 1 hit
SSF52540 SSF52540, 2 hits

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00674 AAA, 1 hit
PS50014 BROMODOMAIN_2, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6PL18-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVVLRSSLEL HNHSAASATG SLDLSSDFLS LEHIGRRRLR SAGAAQKKPA
60 70 80 90 100
ATTAKAGDGS SVKEVETYHR TRALRSLRKD AQNSSDSSFE KNVEITEQLA
110 120 130 140 150
NGRHFTRQLA RQQADKKKEE HREDKVIPVT RSLRARNIVQ STEHLHEDNG
160 170 180 190 200
DVEVRRSCRI RSRYSGVNQS MLFDKLITNT AEAVLQKMDD MKKMRRQRMR
210 220 230 240 250
ELEDLGVFNE TEESNLNMYT RGKQKDIQRT DEETTDNQEG SVESSEEGED
260 270 280 290 300
QEHEDDGEDE DDEDDDDDDD DDDDDDDEDD EDEEDGEEEN QKRYYLRQRK
310 320 330 340 350
ATVYYQAPLE KPRHQRKPNI FYSGPASPAR PRYRLSSAGP RSPYCKRMNR
360 370 380 390 400
RRHAIHSSDS TSSSSSEDEQ HFERRRKRSR NRAINRCLPL NFRKDELKGI
410 420 430 440 450
YKDRMKIGAS LADVDPMQLD SSVRFDSVGG LSNHIAALKE MVVFPLLYPE
460 470 480 490 500
VFEKFKIQPP RGCLFYGPPG TGKTLVARAL ANECSQGDKR VAFFMRKGAD
510 520 530 540 550
CLSKWVGESE RQLRLLFDQA YQMRPSIIFF DEIDGLAPVR SSRQDQIHSS
560 570 580 590 600
IVSTLLALMD GLDSRGEIVV IGATNRLDSI DPALRRPGRF DREFLFSLPD
610 620 630 640 650
KEARKEILKI HTRDWNPKPL DTFLEELAEN CVGYCGADIK SICAEAALCA
660 670 680 690 700
LRRRYPQIYT TSEKLQLDLS SINISAKDFE VAMQKMIPAS QRAVTSPGQA
710 720 730 740 750
LSTVVKPLLQ NTVDKILEAL QRVFPHAEFR TNKTLDSDIS CPLLESDLAY
760 770 780 790 800
SDDDVPSVYE NGLSQKSSHK AKDNFNFLHL NRNACYQPMS FRPRILIVGE
810 820 830 840 850
PGFGQGSHLA PAVIHALEKF TVYTLDIPVL FGVSTTSPEE TCAQVIREAK
860 870 880 890 900
RTAPSIVYVP HIHVWWEIVG PTLKATFTTL LQNIPSFAPV LLLATSDKPH
910 920 930 940 950
SALPEEVQEL FIRDYGEIFN VQLPDKEERT KFFEDLILKQ AAKPPISKKK
960 970 980 990 1000
AVLQALEVLP VAPPPEPRSL TAEEVKRLEE QEEDTFRELR IFLRNVTHRL
1010 1020 1030 1040 1050
AIDKRFRVFT KPVDPDEVPD YVTVIKQPMD LSSVISKIDL HKYLTVKDYL
1060 1070 1080 1090 1100
RDIDLICSNA LEYNPDRDPG DRLIRHRACA LRDTAYAIIK EELDEDFEQL
1110 1120 1130 1140 1150
CEEIQESRKK RGCSSSKYAP SYYHVMPKQN STLVGDKRSD PEQNEKLKTP
1160 1170 1180 1190 1200
STPVACSTPA QLKRKIRKKS NWYLGTIKKR RKISQAKDDS QNAIDHKIES
1210 1220 1230 1240 1250
DTEETQDTSV DHNETGNTGE SSVEENEKQQ NASESKLELR NNSNTCNIEN
1260 1270 1280 1290 1300
ELEDSRKTTA CTELRDKIAC NGDASSSQII HISDENEGKE MCVLRMTRAR
1310 1320 1330 1340 1350
RSQVEQQQLI TVEKALAILS QPTPSLVVDH ERLKNLLKTV VKKSQNYNIF
1360 1370 1380 1390
QLENLYAVIS QCIYRHRKDH DKTSLIQKME QEVENFSCSR
Length:1,390
Mass (Da):158,554
Last modified:July 5, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iF43B30C77BB0F4BA
GO
Isoform 2 (identifier: Q6PL18-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-170: Missing.
     551-582: IVSTLLALMDGLDSRGEIVVIGATNRLDSIDP → YGWIGQQRGNCGHWCYEQARFYRSCFTKAWSL
     583-1390: Missing.

Note: No experimental confirmation available. Dubious isoform. May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:412
Mass (Da):47,986
Checksum:i24E5F0638207B64A
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A0B4J211A0A0B4J211_HUMAN
ATPase family AAA domain-containing...
ATAD2
708Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RIP2E5RIP2_HUMAN
ATPase family AAA domain-containing...
ATAD2
64Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
E5RHW7E5RHW7_HUMAN
ATPase family AAA domain-containing...
ATAD2
63Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAF22032 differs from that shown. Reason: Erroneous initiation.Curated
The sequence AAH10686 differs from that shown. Contaminating sequence. Sequence of unknown origin in the N-terminal part (676-679).Curated
The sequence AAH19909 differs from that shown. Reason: Erroneous initiation.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_0476251280I → T. Corresponds to variant dbSNP:rs3758122Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0156331 – 170Missing in isoform 2. 1 PublicationAdd BLAST170
Alternative sequenceiVSP_015634551 – 582IVSTL…DSIDP → YGWIGQQRGNCGHWCYEQAR FYRSCFTKAWSL in isoform 2. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_015635583 – 1390Missing in isoform 2. 1 PublicationAdd BLAST808

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY598335 mRNA Translation: AAT06746.1
CR749832 mRNA Translation: CAH18688.1
AL833653 mRNA Translation: CAH56229.1
BC010686 mRNA Translation: AAH10686.1 Sequence problems.
BC019909 mRNA Translation: AAH19909.1 Different initiation.
BC113656 mRNA Translation: AAI13657.1
AK097133 mRNA Translation: BAC04959.1
AF118088 mRNA Translation: AAF22032.1 Different initiation.

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS6343.1 [Q6PL18-1]

NCBI Reference Sequences

More...
RefSeqi
NP_054828.2, NM_014109.3 [Q6PL18-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.370834

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000287394; ENSP00000287394; ENSG00000156802 [Q6PL18-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
29028

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:29028

UCSC genome browser

More...
UCSCi
uc003yqh.5 human [Q6PL18-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY598335 mRNA Translation: AAT06746.1
CR749832 mRNA Translation: CAH18688.1
AL833653 mRNA Translation: CAH56229.1
BC010686 mRNA Translation: AAH10686.1 Sequence problems.
BC019909 mRNA Translation: AAH19909.1 Different initiation.
BC113656 mRNA Translation: AAI13657.1
AK097133 mRNA Translation: BAC04959.1
AF118088 mRNA Translation: AAF22032.1 Different initiation.
CCDSiCCDS6343.1 [Q6PL18-1]
RefSeqiNP_054828.2, NM_014109.3 [Q6PL18-1]
UniGeneiHs.370834

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3DAIX-ray1.95A981-1108[»]
4QSPX-ray1.60A981-1108[»]
4QSQX-ray1.80A981-1108[»]
4QSRX-ray2.00A981-1108[»]
4QSSX-ray2.00A981-1108[»]
4QSTX-ray2.05A981-1108[»]
4QSUX-ray1.90A981-1108[»]
4QSVX-ray1.90A981-1108[»]
4QSWX-ray1.80A981-1108[»]
4QSXX-ray1.93A981-1108[»]
4QUTX-ray1.70A981-1108[»]
4QUUX-ray1.80A981-1108[»]
4TT2X-ray2.50A981-1108[»]
4TT4X-ray2.70A/B981-1108[»]
4TT6X-ray2.00A981-1108[»]
4TTEX-ray1.80A981-1108[»]
4TU4X-ray1.73A981-1108[»]
4TU6X-ray2.27A/B/C/D981-1108[»]
4TYLX-ray1.85A981-1108[»]
4TZ2X-ray1.70A981-1108[»]
4TZ8X-ray2.15A981-1108[»]
5A5NX-ray1.95A981-1108[»]
5A5OX-ray2.04A981-1108[»]
5A5PX-ray2.03A981-1108[»]
5A5QX-ray1.97A981-1108[»]
5A5RX-ray2.01A981-1108[»]
5A81X-ray2.03A981-1108[»]
5A82X-ray1.86A981-1108[»]
5A83X-ray2.09A981-1108[»]
5EPBX-ray1.50A981-1108[»]
5F36X-ray1.50A981-1108[»]
5F3AX-ray1.60A981-1108[»]
5LJ0X-ray1.82A981-1108[»]
6HDNX-ray1.90A981-1108[»]
6HDOX-ray2.61A981-1108[»]
ProteinModelPortaliQ6PL18
SMRiQ6PL18
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi118827, 23 interactors
DIPiDIP-46197N
IntActiQ6PL18, 9 interactors
MINTiQ6PL18
STRINGi9606.ENSP00000287394

Chemistry databases

BindingDBiQ6PL18
ChEMBLiCHEMBL2150837
GuidetoPHARMACOLOGYi2719

PTM databases

iPTMnetiQ6PL18
PhosphoSitePlusiQ6PL18

Polymorphism and mutation databases

BioMutaiATAD2
DMDMi74762365

Proteomic databases

EPDiQ6PL18
MaxQBiQ6PL18
PaxDbiQ6PL18
PeptideAtlasiQ6PL18
PRIDEiQ6PL18
ProteomicsDBi67248
67249 [Q6PL18-2]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
29028
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000287394; ENSP00000287394; ENSG00000156802 [Q6PL18-1]
GeneIDi29028
KEGGihsa:29028
UCSCiuc003yqh.5 human [Q6PL18-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
29028
DisGeNETi29028
EuPathDBiHostDB:ENSG00000156802.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ATAD2

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0007764
HGNCiHGNC:30123 ATAD2
HPAiCAB056158
HPA029424
MIMi611941 gene
neXtProtiNX_Q6PL18
OpenTargetsiENSG00000156802
PharmGKBiPA134895566

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0732 Eukaryota
COG0464 LUCA
GeneTreeiENSGT00550000074694
HOVERGENiHBG080873
InParanoidiQ6PL18
KOiK22531
OMAiKSKWYLG
OrthoDBiEOG091G0152
PhylomeDBiQ6PL18
TreeFamiTF314783

Enzyme and pathway databases

ReactomeiR-HSA-8866910 TFAP2 (AP-2) family regulates transcription of growth factors and their receptors

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ATAD2 human
EvolutionaryTraceiQ6PL18

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
29028

Protein Ontology

More...
PROi
PR:Q6PL18

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000156802 Expressed in 174 organ(s), highest expression level in secondary oocyte
CleanExiHS_ATAD2
ExpressionAtlasiQ6PL18 baseline and differential
GenevisibleiQ6PL18 HS

Family and domain databases

Gene3Di1.20.920.10, 1 hit
InterProiView protein in InterPro
IPR003593 AAA+_ATPase
IPR031252 ANCCA
IPR003959 ATPase_AAA_core
IPR003960 ATPase_AAA_CS
IPR001487 Bromodomain
IPR036427 Bromodomain-like_sf
IPR027417 P-loop_NTPase
PANTHERiPTHR23069:SF4 PTHR23069:SF4, 1 hit
PfamiView protein in Pfam
PF00004 AAA, 1 hit
PF00439 Bromodomain, 1 hit
PRINTSiPR00503 BROMODOMAIN
SMARTiView protein in SMART
SM00382 AAA, 1 hit
SM00297 BROMO, 1 hit
SUPFAMiSSF47370 SSF47370, 1 hit
SSF52540 SSF52540, 2 hits
PROSITEiView protein in PROSITE
PS00674 AAA, 1 hit
PS50014 BROMODOMAIN_2, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiATAD2_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6PL18
Secondary accession number(s): Q14CR1
, Q658P2, Q68CQ0, Q6PJV6, Q8N890, Q9UHS5
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 13, 2005
Last sequence update: July 5, 2004
Last modified: December 5, 2018
This is version 139 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  6. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again