Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
The new UniProt website is here! Take me to UniProt BETA

UniProtKB - Q6PIL6 (KCIP4_HUMAN)

Entry version 151 (29 Sep 2021)
Sequence version 1 (05 Jul 2004)
Previous versions | rss
Add a publicationFeedback
Protein

Kv channel-interacting protein 4

Gene

KCNIP4

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels. Modulates KCND2 channel density, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner (PubMed:11847232, PubMed:18957440, PubMed:23576435).

Modulates KCND3/Kv4.3 currents (PubMed:23576435).

Isoform 4 does not increase KCND2 expression at the cell membrane (PubMed:18957440).

Isoform 4 retains KCND3 in the endoplasmic reticulum and negatively regulates its expression at the cell membrane.

By similarity3 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section specifies the position(s) of the calcium-binding region(s) within the protein. One common calcium-binding motif is the EF-hand, but other calcium-binding motifs also exist.<p><a href='/help/ca_bind' target='_top'>More...</a></p>Calcium bindingi133 – 1441PROSITE-ProRule annotationAdd BLAST12
Calcium bindingi169 – 1802PROSITE-ProRule annotationAdd BLAST12
Calcium bindingi217 – 2283PROSITE-ProRule annotationAdd BLAST12

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

Complete GO annotation on QuickGO ...

GO - Biological processi

Complete GO annotation on QuickGO ...

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionIon channel, Potassium channel, Voltage-gated channel
Biological processIon transport, Potassium transport, Transport
LigandCalcium, Metal-binding, Potassium

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q6PIL6

Reactome - a knowledgebase of biological pathways and processes

More...Reactomei		R-HSA-5576894, Phase 1 - inactivation of fast Na+ channels

Protein family/group databases

Transport Classification Database

More...TCDBi		8.A.82.2.2, the calmodulin calcium binding protein (calmodulin) family

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Kv channel-interacting protein 4
Short name:
KChIP41 Publication
Alternative name(s):
A-type potassium channel modulatory protein 4
Calsenilin-like protein1 Publication
Potassium channel-interacting protein 4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:KCNIP4
Synonyms:CALP, KCHIP4
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 4

Organism-specific databases

Human Gene Nomenclature Database

More...HGNCi		HGNC:30083, KCNIP4

Online Mendelian Inheritance in Man (OMIM)

More...MIMi		608182, gene

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q6PIL6

Eukaryotic Pathogen, Vector and Host Database Resources

More...VEuPathDBi		HostDB:ENSG00000185774

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Endoplasmic reticulum, Membrane

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		80333

Open Targets

More...OpenTargetsi		ENSG00000185774

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA134893552

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q6PIL6, Tbio

Genetic variation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		KCNIP4

Domain mapping of disease mutations (DMDM)

More...DMDMi		73621129

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000738251 – 250Kv channel-interacting protein 4Add BLAST250

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei17PhosphoserineBy similarity1
Modified residuei56PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q6PIL6

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q6PIL6

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q6PIL6

PeptideAtlas

More...PeptideAtlasi		Q6PIL6

PRoteomics IDEntifications database

More...PRIDEi		Q6PIL6

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		67166 [Q6PIL6-1]
67167 [Q6PIL6-2]
67168 [Q6PIL6-3]
67169 [Q6PIL6-4]
67170 [Q6PIL6-5]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q6PIL6

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q6PIL6

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Predominantly expressed in brain.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000185774, Expressed in frontal cortex and 168 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q6PIL6, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q6PIL6, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000185774, Tissue enhanced (brain)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Component of heteromultimeric potassium channels (PubMed:23576435). Identified in potassium channel complexes containing KCND1, KCND2, KCND3, KCNIP1, KCNIP2, KCNIP3, KCNIP4, DPP6 and DPP10 (By similarity).

Interacts with KCND2 (PubMed:11847232, PubMed:18957440).

Interacts with KCND3 (By similarity).

Interacts with the C-terminus of PSEN2 and probably PSEN1 (PubMed:11847232).

By similarity4 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		123244, 22 interactors

CORUM comprehensive resource of mammalian protein complexes

More...CORUMi		Q6PIL6

Protein interaction database and analysis system

More...IntActi		Q6PIL6, 17 interactors

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000371587

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q6PIL6, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Biological Magnetic Resonance Data Bank

More...BMRBi		Q6PIL6

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...SMRi		Q6PIL6

Database of comparative protein structure models

More...ModBasei		Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini61 – 117EF-hand 1; degeneratePROSITE-ProRule annotationAdd BLAST57
Domaini120 – 155EF-hand 2PROSITE-ProRule annotationAdd BLAST36
Domaini156 – 191EF-hand 3PROSITE-ProRule annotationAdd BLAST36
Domaini204 – 239EF-hand 4PROSITE-ProRule annotationAdd BLAST36

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes a region of interest that cannot be described in other subsections.<p><a href='/help/region' target='_top'>More...</a></p>Regioni2 – 44KISBy similarityAdd BLAST43
Regioni237 – 250Interaction with KCND2By similarityAdd BLAST14

<p>This subsection of the 'Family and domains' section provides general information on the biological role of a domain. The term 'domain' is intended here in its wide acceptation, it may be a structural domain, a transmembrane region or a functional domain. Several domains are described in this subsection.<p><a href='/help/domain_cc' target='_top'>More...</a></p>Domaini

The KIS (K-channel inactivation suppressor) domain is required for converting A-type Kv4 current to a slowly inactivating delayed rectifier potassium current.By similarity

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the recoverin family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		KOG0044, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00940000158985

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_072366_5_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q6PIL6

Identification of Orthologs from Complete Genome Data

More...OMAi		PHLKCIT

Database of Orthologous Groups

More...OrthoDBi		1513542at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q6PIL6

TreeFam database of animal gene trees

More...TreeFami		TF318560

Family and domain databases

Conserved Domains Database

More...CDDi		cd00051, EFh, 2 hits

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR011992, EF-hand-dom_pair
IPR018247, EF_Hand_1_Ca_BS
IPR002048, EF_hand_dom
IPR028846, Recoverin

The PANTHER Classification System

More...PANTHERi		PTHR23055, PTHR23055, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF13499, EF-hand_7, 1 hit
PF13833, EF-hand_8, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...SMARTi		View protein in SMART
SM00054, EFh, 3 hits

Superfamily database of structural and functional annotation

More...SUPFAMi		SSF47473, SSF47473, 1 hit

PROSITE; a protein domain and family database

More...PROSITEi		View protein in PROSITE
PS00018, EF_HAND_1, 3 hits
PS50222, EF_HAND_2, 3 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6PIL6-1) [UniParc]FASTAAdd to basket
Also known as: KChIP4.1

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNVRRVESIS AQLEEASSTG GFLYAQNSTK RSIKERLMKL LPCSAAKTSS 
        60         70         80         90        100
PAIQNSVEDE LEMATVRHRP EALELLEAQS KFTKKELQIL YRGFKNECPS 
       110        120        130        140        150
GVVNEETFKE IYSQFFPQGD STTYAHFLFN AFDTDHNGAV SFEDFIKGLS 
       160        170        180        190        200
ILLRGTVQEK LNWAFNLYDI NKDGYITKEE MLDIMKAIYD MMGKCTYPVL 
       210        220        230        240        250
KEDAPRQHVE TFFQKMDKNK DGVVTIDEFI ESCQKDENIM RSMQLFENVI
Length:250
Mass (Da):28,729
Last modified:July 5, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iDC6C758D73468092
GO
Isoform 2 (identifier: Q6PIL6-2) [UniParc]FASTAAdd to basket
Also known as: KChIP4.2

The sequence of this isoform differs from the canonical sequence as follows:
     21-55: GFLYAQNSTKRSIKERLMKLLPCSAAKTSSPAIQN → D

Show »
Length:216
Mass (Da):25,008
Checksum:i17C4AFD3B4CFF23C
GO
Isoform 3 (identifier: Q6PIL6-3) [UniParc]FASTAAdd to basket
Also known as: KChIP4bs, KCHIP4.2

The sequence of this isoform differs from the canonical sequence as follows:
     1-62: Missing.

Show »
Length:188
Mass (Da):21,945
Checksum:i9F46CA3A8A308410
GO
Isoform 4 (identifier: Q6PIL6-4) [UniParc]FASTAAdd to basket
Also known as: KChIP4a, KChIP4.4

The sequence of this isoform differs from the canonical sequence as follows:
     1-55: MNVRRVESIS...AKTSSPAIQN → MNLEGLEMIAVLIVIVLFVKLLEQFGLIEAGLED

Show »
Length:229
Mass (Da):26,502
Checksum:i08DF864F1A838BE8
GO
Isoform 5 (identifier: Q6PIL6-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-55: MNVRRVESIS...AKTSSPAIQN → MSGCRKRCKREILKFAQYLLRLLTGSLHTD

Show »
Length:225
Mass (Da):26,267
Checksum:iB140E66E43A89049
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q3YAB7Q3YAB7_HUMAN
Kv channel-interacting protein 4
KCNIP4
233Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H395F5H395_HUMAN
Kv channel-interacting protein 4
KCNIP4
34Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0G2JRL8A0A0G2JRL8_HUMAN
Kv channel-interacting protein 4
KCNIP4
29Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti29T → I in AAG36974 (PubMed:11847232).Curated1
Sequence conflicti29T → I in AAK53713 (Ref. 3) Curated1
Sequence conflicti32S → N in AAG36974 (PubMed:11847232).Curated1
Sequence conflicti32S → N in AAK53713 (Ref. 3) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0150661 – 62Missing in isoform 3. 3 PublicationsAdd BLAST62
Alternative sequenceiVSP_0150671 – 55MNVRR…PAIQN → MNLEGLEMIAVLIVIVLFVK LLEQFGLIEAGLED in isoform 4. 2 PublicationsAdd BLAST55
Alternative sequenceiVSP_0433211 – 55MNVRR…PAIQN → MSGCRKRCKREILKFAQYLL RLLTGSLHTD in isoform 5. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_01506821 – 55GFLYA…PAIQN → D in isoform 2. 3 PublicationsAdd BLAST35

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AF302044 mRNA Translation: AAG36974.1
AF305072 mRNA Translation: AAG36977.1
AF453246 mRNA Translation: AAL86769.1
AF367023 mRNA Translation: AAK53712.1
AF367024 mRNA Translation: AAK53713.1
AY029176 mRNA Translation: AAK31594.1
AY118170 mRNA Translation: AAM81578.1
DQ148487 mRNA Translation: AAZ77804.1
DQ148488 mRNA Translation: AAZ77805.1
DQ148489 mRNA Translation: AAZ77806.1
DQ148490 mRNA Translation: AAZ77807.1
DQ148491 mRNA Translation: AAZ77808.1
AK289922 mRNA Translation: BAF82611.1
AC096576 Genomic DNA No translation available.
AC097505 Genomic DNA No translation available.
AC098597 Genomic DNA No translation available.
AC104065 Genomic DNA Translation: AAY40911.1
AC107462 Genomic DNA No translation available.
AC108147 Genomic DNA No translation available.
AC109360 Genomic DNA No translation available.
AC109636 Genomic DNA No translation available.
AC110296 Genomic DNA No translation available.
AC110612 Genomic DNA No translation available.
AC113606 Genomic DNA No translation available.
AC116641 Genomic DNA No translation available.
CH471069 Genomic DNA Translation: EAW92798.1
BC032520 mRNA Translation: AAH32520.1

The Consensus CDS (CCDS) project

More...CCDSi		CCDS3428.1 [Q6PIL6-4]
CCDS43215.1 [Q6PIL6-2]
CCDS43216.1 [Q6PIL6-1]
CCDS43217.1 [Q6PIL6-5]
CCDS47035.1 [Q6PIL6-3]

NCBI Reference Sequences

More...RefSeqi		NP_001030175.1, NM_001035003.1 [Q6PIL6-5]
NP_001030176.1, NM_001035004.1 [Q6PIL6-3]
NP_079497.2, NM_025221.5 [Q6PIL6-1]
NP_671710.1, NM_147181.3 [Q6PIL6-2]
NP_671711.1, NM_147182.3 [Q6PIL6-3]
NP_671712.1, NM_147183.3 [Q6PIL6-4]
XP_016864142.1, XM_017008653.1 [Q6PIL6-3]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000359001; ENSP00000351892; ENSG00000185774 [Q6PIL6-3]
ENST00000382148; ENSP00000371583; ENSG00000185774 [Q6PIL6-5]
ENST00000382150; ENSP00000371585; ENSG00000185774 [Q6PIL6-4]
ENST00000382152; ENSP00000371587; ENSG00000185774 [Q6PIL6-1]
ENST00000447367; ENSP00000399080; ENSG00000185774 [Q6PIL6-2]
ENST00000509207; ENSP00000423257; ENSG00000185774 [Q6PIL6-3]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		80333

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:80333

UCSC genome browser

More...UCSCi		uc003gqf.2, human [Q6PIL6-1]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF302044 mRNA Translation: AAG36974.1
AF305072 mRNA Translation: AAG36977.1
AF453246 mRNA Translation: AAL86769.1
AF367023 mRNA Translation: AAK53712.1
AF367024 mRNA Translation: AAK53713.1
AY029176 mRNA Translation: AAK31594.1
AY118170 mRNA Translation: AAM81578.1
DQ148487 mRNA Translation: AAZ77804.1
DQ148488 mRNA Translation: AAZ77805.1
DQ148489 mRNA Translation: AAZ77806.1
DQ148490 mRNA Translation: AAZ77807.1
DQ148491 mRNA Translation: AAZ77808.1
AK289922 mRNA Translation: BAF82611.1
AC096576 Genomic DNA No translation available.
AC097505 Genomic DNA No translation available.
AC098597 Genomic DNA No translation available.
AC104065 Genomic DNA Translation: AAY40911.1
AC107462 Genomic DNA No translation available.
AC108147 Genomic DNA No translation available.
AC109360 Genomic DNA No translation available.
AC109636 Genomic DNA No translation available.
AC110296 Genomic DNA No translation available.
AC110612 Genomic DNA No translation available.
AC113606 Genomic DNA No translation available.
AC116641 Genomic DNA No translation available.
CH471069 Genomic DNA Translation: EAW92798.1
BC032520 mRNA Translation: AAH32520.1
CCDSiCCDS3428.1 [Q6PIL6-4]
CCDS43215.1 [Q6PIL6-2]
CCDS43216.1 [Q6PIL6-1]
CCDS43217.1 [Q6PIL6-5]
CCDS47035.1 [Q6PIL6-3]
RefSeqiNP_001030175.1, NM_001035003.1 [Q6PIL6-5]
NP_001030176.1, NM_001035004.1 [Q6PIL6-3]
NP_079497.2, NM_025221.5 [Q6PIL6-1]
NP_671710.1, NM_147181.3 [Q6PIL6-2]
NP_671711.1, NM_147182.3 [Q6PIL6-3]
NP_671712.1, NM_147183.3 [Q6PIL6-4]
XP_016864142.1, XM_017008653.1 [Q6PIL6-3]

3D structure databases

BMRBiQ6PIL6
SMRiQ6PIL6
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi123244, 22 interactors
CORUMiQ6PIL6
IntActiQ6PIL6, 17 interactors
STRINGi9606.ENSP00000371587

Protein family/group databases

TCDBi8.A.82.2.2, the calmodulin calcium binding protein (calmodulin) family

PTM databases

iPTMnetiQ6PIL6
PhosphoSitePlusiQ6PIL6

Genetic variation databases

BioMutaiKCNIP4
DMDMi73621129

Proteomic databases

EPDiQ6PIL6
MassIVEiQ6PIL6
PaxDbiQ6PIL6
PeptideAtlasiQ6PIL6
PRIDEiQ6PIL6
ProteomicsDBi67166 [Q6PIL6-1]
67167 [Q6PIL6-2]
67168 [Q6PIL6-3]
67169 [Q6PIL6-4]
67170 [Q6PIL6-5]

Protocols and materials databases

ABCD curated depository of sequenced antibodies

More...ABCDi		Q6PIL6, 2 sequenced antibodies

Antibodypedia a portal for validated antibodies

More...Antibodypediai		10064, 197 antibodies

The DNASU plasmid repository

More...DNASUi		80333

Genome annotation databases

EnsembliENST00000359001; ENSP00000351892; ENSG00000185774 [Q6PIL6-3]
ENST00000382148; ENSP00000371583; ENSG00000185774 [Q6PIL6-5]
ENST00000382150; ENSP00000371585; ENSG00000185774 [Q6PIL6-4]
ENST00000382152; ENSP00000371587; ENSG00000185774 [Q6PIL6-1]
ENST00000447367; ENSP00000399080; ENSG00000185774 [Q6PIL6-2]
ENST00000509207; ENSP00000423257; ENSG00000185774 [Q6PIL6-3]
GeneIDi80333
KEGGihsa:80333
UCSCiuc003gqf.2, human [Q6PIL6-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		80333
DisGeNETi80333

GeneCards: human genes, protein and diseases

More...GeneCardsi		KCNIP4
HGNCiHGNC:30083, KCNIP4
HPAiENSG00000185774, Tissue enhanced (brain)
MIMi608182, gene
neXtProtiNX_Q6PIL6
OpenTargetsiENSG00000185774
PharmGKBiPA134893552
VEuPathDBiHostDB:ENSG00000185774

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiKOG0044, Eukaryota
GeneTreeiENSGT00940000158985
HOGENOMiCLU_072366_5_0_1
InParanoidiQ6PIL6
OMAiPHLKCIT
OrthoDBi1513542at2759
PhylomeDBiQ6PIL6
TreeFamiTF318560

Enzyme and pathway databases

PathwayCommonsiQ6PIL6
ReactomeiR-HSA-5576894, Phase 1 - inactivation of fast Na+ channels

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		80333, 7 hits in 1011 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		KCNIP4, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		80333
PharosiQ6PIL6, Tbio

Protein Ontology

More...PROi		PR:Q6PIL6
RNActiQ6PIL6, protein

The Stanford Online Universal Resource for Clones and ESTs

More...SOURCEi		Search...

Gene expression databases

BgeeiENSG00000185774, Expressed in frontal cortex and 168 other tissues
ExpressionAtlasiQ6PIL6, baseline and differential
GenevisibleiQ6PIL6, HS

Family and domain databases

CDDicd00051, EFh, 2 hits
InterProiView protein in InterPro
IPR011992, EF-hand-dom_pair
IPR018247, EF_Hand_1_Ca_BS
IPR002048, EF_hand_dom
IPR028846, Recoverin
PANTHERiPTHR23055, PTHR23055, 1 hit
PfamiView protein in Pfam
PF13499, EF-hand_7, 1 hit
PF13833, EF-hand_8, 1 hit
SMARTiView protein in SMART
SM00054, EFh, 3 hits
SUPFAMiSSF47473, SSF47473, 1 hit
PROSITEiView protein in PROSITE
PS00018, EF_HAND_1, 3 hits
PS50222, EF_HAND_2, 3 hits

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiKCIP4_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6PIL6
Secondary accession number(s): Q3YAB8
, Q3YAB9, Q3YAC0, Q3YAC1, Q3YAC2, Q4W5G8, Q8NEU0, Q9BWT2, Q9H294, Q9H2A4
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2005
Last sequence update: July 5, 2004
Last modified: September 29, 2021
This is version 151 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human chromosome 4
    Human chromosome 4: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again