Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 120 (13 Feb 2019)
Sequence version 2 (11 Sep 2007)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Protein SHQ1 homolog

Gene

SHQ1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Required for the quantitative accumulation of H/ACA ribonucleoproteins (RNPs), including telomerase, probably through the stabilization of DKC1, from the time of its synthesis until its association with NOP10, NHP2, and NAF1 at the nascent H/ACA RNA.1 Publication

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • unfolded protein binding Source: GO_Central

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Protein SHQ1 homolog
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:SHQ1
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 3

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000144736.13

Human Gene Nomenclature Database

More...
HGNCi
HGNC:25543 SHQ1

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
613663 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6PI26

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Nucleus

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...
DisGeNETi
55164

Open Targets

More...
OpenTargetsi
ENSG00000144736

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA142670921

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
SHQ1

Domain mapping of disease mutations (DMDM)

More...
DMDMi
158563966

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003028221 – 577Protein SHQ1 homologAdd BLAST577

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q6PI26

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6PI26

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q6PI26

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6PI26

PeptideAtlas

More...
PeptideAtlasi
Q6PI26

PRoteomics IDEntifications database

More...
PRIDEi
Q6PI26

ProteomicsDB human proteome resource

More...
ProteomicsDBi
67135

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6PI26

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6PI26

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000144736 Expressed in 221 organ(s), highest expression level in female gonad

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6PI26 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6PI26 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA042792

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Directly interacts with DKC1 alone, but not in the context of the core trimer composed of DKC1, NOP10 and NHP2, nor in the presence of NAF1. Does not interact with NAF1.1 Publication

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
120464, 17 interactors

Protein interaction database and analysis system

More...
IntActi
Q6PI26, 7 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000315182

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1577
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2MNWNMR-A1-96[»]
4PBDX-ray1.68A1-96[»]
4PCKX-ray2.40A/B1-96[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q6PI26

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6PI26

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini1 – 89CSPROSITE-ProRule annotationAdd BLAST89

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and Domains’ section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi441 – 490Ser-richAdd BLAST50

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the SHQ1 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG3247 Eukaryota
ENOG410ZIEU LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000007605

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000070000

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG062935

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6PI26

KEGG Orthology (KO)

More...
KOi
K14764

Identification of Orthologs from Complete Genome Data

More...
OMAi
ITDYCIW

Database of Orthologous Groups

More...
OrthoDBi
879404at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6PI26

TreeFam database of animal gene trees

More...
TreeFami
TF106118

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
2.60.40.790, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR007052 CS_dom
IPR008978 HSP20-like_chaperone
IPR039742 Shq1
IPR007009 Shq1_dom

The PANTHER Classification System

More...
PANTHERi
PTHR12967 PTHR12967, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04925 SHQ1, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF49764 SSF49764, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51203 CS, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6PI26-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MLTPAFDLSQ DPDFLTIAIR VPYARVSEFD VYFEGSDFKF YAKPYFLRLT
60 70 80 90 100
LPGRIVENGS EQGSYDADKG IFTIRLPKET PGQHFEGLNM LTALLAPRKS
110 120 130 140 150
RTAKPLVEEI GASEIPEEVV DDEEFDWEIE QTPCEEVSES ALNPQCHYGF
160 170 180 190 200
GNLRSGVLQR LQDELSDVID IKDPDFTPAA ERRQKRLAAE LAKFDPDHYL
210 220 230 240 250
ADFFEDEAIE QILKYNPWWT DKYSKMMAFL EKSQEQENHA TLVSFSEEEK
260 270 280 290 300
YQLRKFVNKS YLLDKRACRQ VCYSLIDILL AYCYETRVTE GEKNVESAWN
310 320 330 340 350
IRKLSPTLCW FETWTNVHDI MVSFGRRVLC YPLYRHFKLV MKAYRDTIKI
360 370 380 390 400
LQLGKSAVLK CLLDIHKIFQ ENDPAYILND LYISDYCVWI QKVKSKKLAA
410 420 430 440 450
LAEALKEVSL TKAQLGLELE ELEAAALLVQ EEETALKAAH SVSGQQTLCS
460 470 480 490 500
SSEASDSEDS DSSVSSGNED SGSDSEQDEL KDSPSETVSS LQGPFLEESS
510 520 530 540 550
AFLIVDGGVR RNTAIQESDA SQGKPLASSW PLGVSGPLIE ELGEQLKTTV
560 570
QVSEPKGTTA VNRSNIQERD GCQTPNN
Length:577
Mass (Da):65,125
Last modified:September 11, 2007 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i277C2FC532A4D570
GO
Isoform 2 (identifier: Q6PI26-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-48: MLTPAFDLSQDPDFLTIAIRVPYARVSEFDVYFEGSDFKFYAKPYFLR → MNKTWSLSLKNGDCSCGGPI

Note: No experimental confirmation available.
Show »
Length:549
Mass (Da):61,548
Checksum:iB74B45664C41ACE1
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F8WDZ9F8WDZ9_HUMAN
Protein SHQ1 homolog
SHQ1
50Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
C9J6N3C9J6N3_HUMAN
Protein SHQ1 homolog
SHQ1
110Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F8WBC6F8WBC6_HUMAN
Protein SHQ1 homolog
SHQ1
63Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAA91669 differs from that shown. Reason: Frameshift at position 79.Curated
The sequence BAB14947 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti128E → Q in BAB14947 (PubMed:14702039).Curated1
Sequence conflicti505V → A in BAA91669 (PubMed:14702039).Curated1
Sequence conflicti506D → G in BAB14947 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_034962140S → I1 PublicationCorresponds to variant dbSNP:rs17855677Ensembl.1
Natural variantiVAR_034963489S → N2 PublicationsCorresponds to variant dbSNP:rs35178407Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0561051 – 48MLTPA…PYFLR → MNKTWSLSLKNGDCSCGGPI in isoform 2. 1 PublicationAdd BLAST48

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK001401 mRNA Translation: BAA91669.1 Frameshift.
AK024656 mRNA Translation: BAB14947.1 Different initiation.
AK296789 mRNA Translation: BAG59367.1
AC114876 Genomic DNA No translation available.
AC134050 Genomic DNA No translation available.
BC017204 mRNA Translation: AAH17204.1
BC017274 mRNA Translation: AAH17274.1
BC025270 mRNA Translation: AAH25270.1
BC032671 mRNA Translation: AAH32671.1
BC039830 mRNA Translation: AAH39830.1
BC047879 mRNA Translation: AAH47879.1
BX641074 mRNA Translation: CAE46037.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS33788.1 [Q6PI26-1]

NCBI Reference Sequences

More...
RefSeqi
NP_060600.2, NM_018130.2 [Q6PI26-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.606584

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000325599; ENSP00000315182; ENSG00000144736 [Q6PI26-1]
ENST00000463369; ENSP00000417452; ENSG00000144736 [Q6PI26-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
55164

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:55164

UCSC genome browser

More...
UCSCi
uc003dpf.4 human [Q6PI26-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK001401 mRNA Translation: BAA91669.1 Frameshift.
AK024656 mRNA Translation: BAB14947.1 Different initiation.
AK296789 mRNA Translation: BAG59367.1
AC114876 Genomic DNA No translation available.
AC134050 Genomic DNA No translation available.
BC017204 mRNA Translation: AAH17204.1
BC017274 mRNA Translation: AAH17274.1
BC025270 mRNA Translation: AAH25270.1
BC032671 mRNA Translation: AAH32671.1
BC039830 mRNA Translation: AAH39830.1
BC047879 mRNA Translation: AAH47879.1
BX641074 mRNA Translation: CAE46037.1
CCDSiCCDS33788.1 [Q6PI26-1]
RefSeqiNP_060600.2, NM_018130.2 [Q6PI26-1]
UniGeneiHs.606584

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2MNWNMR-A1-96[»]
4PBDX-ray1.68A1-96[»]
4PCKX-ray2.40A/B1-96[»]
ProteinModelPortaliQ6PI26
SMRiQ6PI26
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120464, 17 interactors
IntActiQ6PI26, 7 interactors
STRINGi9606.ENSP00000315182

PTM databases

iPTMnetiQ6PI26
PhosphoSitePlusiQ6PI26

Polymorphism and mutation databases

BioMutaiSHQ1
DMDMi158563966

Proteomic databases

EPDiQ6PI26
jPOSTiQ6PI26
MaxQBiQ6PI26
PaxDbiQ6PI26
PeptideAtlasiQ6PI26
PRIDEiQ6PI26
ProteomicsDBi67135

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000325599; ENSP00000315182; ENSG00000144736 [Q6PI26-1]
ENST00000463369; ENSP00000417452; ENSG00000144736 [Q6PI26-2]
GeneIDi55164
KEGGihsa:55164
UCSCiuc003dpf.4 human [Q6PI26-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
55164
DisGeNETi55164
EuPathDBiHostDB:ENSG00000144736.13

GeneCards: human genes, protein and diseases

More...
GeneCardsi
SHQ1

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0003461
HGNCiHGNC:25543 SHQ1
HPAiHPA042792
MIMi613663 gene
neXtProtiNX_Q6PI26
OpenTargetsiENSG00000144736
PharmGKBiPA142670921

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG3247 Eukaryota
ENOG410ZIEU LUCA
GeneTreeiENSGT00390000007605
HOGENOMiHOG000070000
HOVERGENiHBG062935
InParanoidiQ6PI26
KOiK14764
OMAiITDYCIW
OrthoDBi879404at2759
PhylomeDBiQ6PI26
TreeFamiTF106118

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
55164

Protein Ontology

More...
PROi
PR:Q6PI26

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000144736 Expressed in 221 organ(s), highest expression level in female gonad
ExpressionAtlasiQ6PI26 baseline and differential
GenevisibleiQ6PI26 HS

Family and domain databases

Gene3Di2.60.40.790, 1 hit
InterProiView protein in InterPro
IPR007052 CS_dom
IPR008978 HSP20-like_chaperone
IPR039742 Shq1
IPR007009 Shq1_dom
PANTHERiPTHR12967 PTHR12967, 1 hit
PfamiView protein in Pfam
PF04925 SHQ1, 1 hit
SUPFAMiSSF49764 SSF49764, 1 hit
PROSITEiView protein in PROSITE
PS51203 CS, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSHQ1_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6PI26
Secondary accession number(s): B4DL05
, Q6MZJ4, Q7Z748, Q9H7E5, Q9NVS8
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: September 11, 2007
Last modified: February 13, 2019
This is version 120 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again