Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Kv channel-interacting protein 4

Gene

Kcnip4

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Regulatory subunit of Kv4/D (Shal)-type voltage-gated rapidly inactivating A-type potassium channels, such as KCND2/Kv4.2 and KCND3/Kv4.3 (PubMed:19109250). Modulates channel expression at the cell membrane, gating characteristics, inactivation kinetics and rate of recovery from inactivation in a calcium-dependent and isoform-specific manner.3 Publications

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Calcium bindingi133 – 1441PROSITE-ProRule annotationAdd BLAST12
Calcium bindingi169 – 1802PROSITE-ProRule annotation1 PublicationAdd BLAST12
Calcium bindingi217 – 2283PROSITE-ProRule annotation1 PublicationAdd BLAST12

GO - Molecular functioni

  • calcium ion binding Source: UniProtKB
  • potassium channel activity Source: UniProtKB-KW
  • potassium channel regulator activity Source: UniProtKB
  • voltage-gated ion channel activity Source: UniProtKB-KW

GO - Biological processi

Keywordsi

Molecular functionIon channel, Potassium channel, Voltage-gated channel
Biological processIon transport, Potassium transport, Transport
LigandCalcium, Metal-binding, Potassium

Enzyme and pathway databases

ReactomeiR-MMU-5576894 Phase 1 - inactivation of fast Na+ channels

Names & Taxonomyi

Protein namesi
Recommended name:
Kv channel-interacting protein 4
Short name:
KChIP4
Alternative name(s):
A-type potassium channel modulatory protein 4
Calsenilin-like protein
Potassium channel-interacting protein 4
Gene namesi
Name:Kcnip4
Synonyms:Calp, Kchip4
OrganismiMus musculus (Mouse)
Taxonomic identifieri10090 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
Proteomesi
  • UP000000589 Componenti: Chromosome 5

Organism-specific databases

MGIiMGI:1933131 Kcnip4

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000738271 – 250Kv channel-interacting protein 4Add BLAST250

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei17PhosphoserineCombined sources1
Modified residuei56PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PaxDbiQ6PHZ8
PRIDEiQ6PHZ8

PTM databases

iPTMnetiQ6PHZ8
PhosphoSitePlusiQ6PHZ8

Expressioni

Tissue specificityi

Expressed in brain. Highly expressed by neurons in layers II-IV of cortex and in hippocampus, thalamus and the Purkinje cell layer of the cerebellum.3 Publications

Gene expression databases

BgeeiENSMUSG00000029088 Expressed in 174 organ(s), highest expression level in cerebellum
CleanExiMM_KCNIP4
ExpressionAtlasiQ6PHZ8 baseline and differential
GenevisibleiQ6PHZ8 MM

Interactioni

Subunit structurei

Component of heteromultimeric potassium channels (PubMed:19713751, PubMed:20943905). Identified in potassium channel complexes containing KCND1, KCND2, KCND3, KCNIP1, KCNIP2, KCNIP3, KCNIP4, DPP6 and DPP10 (PubMed:19713751). Interacts with the C-terminus of PSEN2 and probably PSEN1 (By similarity). Interacts with KCND2 and KCND3.By similarity4 Publications

Protein-protein interaction databases

IntActiQ6PHZ8, 1 interactor
MINTiQ6PHZ8
STRINGi10090.ENSMUSP00000084656

Structurei

Secondary structure

1250
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

ProteinModelPortaliQ6PHZ8
SMRiQ6PHZ8
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ6PHZ8

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini61 – 117EF-hand 1; degeneratePROSITE-ProRule annotationAdd BLAST57
Domaini120 – 155EF-hand 2PROSITE-ProRule annotationAdd BLAST36
Domaini156 – 191EF-hand 3PROSITE-ProRule annotationAdd BLAST36
Domaini204 – 239EF-hand 4PROSITE-ProRule annotationAdd BLAST36

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni2 – 44KISAdd BLAST43
Regioni237 – 250Interaction with KCND2By similarityAdd BLAST14

Domaini

The KIS (K-channel inactivation suppressor) domain is required for converting A-type Kv4 current to a slowly inactivating delayed rectifier potassium current.1 Publication

Sequence similaritiesi

Belongs to the recoverin family.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0044 Eukaryota
COG5126 LUCA
GeneTreeiENSGT00760000118820
HOGENOMiHOG000233019
HOVERGENiHBG108179
InParanoidiQ6PHZ8
OMAiDTVEDEM
OrthoDBiEOG091G11T4
PhylomeDBiQ6PHZ8
TreeFamiTF318560

Family and domain databases

CDDicd00051 EFh, 2 hits
InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
PfamiView protein in Pfam
PF13499 EF-hand_7, 1 hit
PF13833 EF-hand_8, 1 hit
SMARTiView protein in SMART
SM00054 EFh, 3 hits
SUPFAMiSSF47473 SSF47473, 1 hit
PROSITEiView protein in PROSITE
PS00018 EF_HAND_1, 3 hits
PS50222 EF_HAND_2, 3 hits

Sequences (4+)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 2 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6PHZ8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MNVRRVESIS AQLEEASSTG GFLYAQNNTK RSIKERLMKL LPCSAAKTSS
60 70 80 90 100
PAIQNSVEDE LEMATVRHRP EALELLEAQS KFTKKELQIL YRGFKNECPS
110 120 130 140 150
GVVNEETFKE IYSQFFPQGD STTYAHFLFN AFDTDHNGAV SFEDFIKGLS
160 170 180 190 200
ILLRGTVQEK LNWAFNLYDI NKDGYITKEE MLDIMKAIYD MMGKCTYPVL
210 220 230 240 250
KEDAPRQHVE TFFQKMDKNK DGVVTIDEFI ESCQKDENIM RSMQLFENVI
Length:250
Mass (Da):28,756
Last modified:July 19, 2004 - v1
Checksum:i56542298021192BF
GO
Isoform 2 (identifier: Q6PHZ8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     21-55: GFLYAQNNTKRSIKERLMKLLPCSAAKTSSPAIQN → D

Note: Derived from EST data. No experimental confirmation available.
Show »
Length:216
Mass (Da):25,008
Checksum:i17C4AFD3B4CFF23C
GO
Isoform 3 (identifier: Q6PHZ8-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-62: Missing.

Show »
Length:188
Mass (Da):21,945
Checksum:i9F46CA3A8A308410
GO
Isoform 4 (identifier: Q6PHZ8-4) [UniParc]FASTAAdd to basket
Also known as: KChIPa

The sequence of this isoform differs from the canonical sequence as follows:
     1-55: MNVRRVESIS...AKTSSPAIQN → MNLEGLEMIAVLIVIVLFVKLLEQFGLIEAGLED

Show »
Length:229
Mass (Da):26,502
Checksum:i08DF864F1A838BE8
GO

Computationally mapped potential isoform sequencesi

There are 2 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q3UFC0Q3UFC0_MOUSE
Kv channel-interacting protein 4
Kcnip4
225Annotation score:
Q3YAA5Q3YAA5_MOUSE
Kv channel interacting protein 4, i...
Kcnip4 mCG_8314
233Annotation score:

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti32S → T in AAG36976 (PubMed:11847232).Curated1
Sequence conflicti67R → K in BAC30218 (PubMed:16141072).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0150691 – 62Missing in isoform 3. 1 PublicationAdd BLAST62
Alternative sequenceiVSP_0150701 – 55MNVRR…PAIQN → MNLEGLEMIAVLIVIVLFVK LLEQFGLIEAGLED in isoform 4. 2 PublicationsAdd BLAST55
Alternative sequenceiVSP_01507121 – 55GFLYA…PAIQN → D in isoform 2. 1 PublicationAdd BLAST35

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF305071 mRNA Translation: AAG36976.1
AF453243 mRNA Translation: AAL86766.1
AY647240 mRNA Translation: AAT68466.1
AK039048 mRNA Translation: BAC30218.1
BC051130 mRNA Translation: AAH51130.1
CK618709 mRNA No translation available.
CCDSiCCDS39084.1 [Q6PHZ8-4]
CCDS57341.1 [Q6PHZ8-2]
CCDS57342.1 [Q6PHZ8-1]
RefSeqiNP_001186171.1, NM_001199242.1 [Q6PHZ8-1]
NP_001186172.1, NM_001199243.1 [Q6PHZ8-2]
NP_084541.3, NM_030265.3 [Q6PHZ8-4]
UniGeneiMm.160172

Genome annotation databases

EnsembliENSMUST00000087395; ENSMUSP00000084656; ENSMUSG00000029088 [Q6PHZ8-1]
ENSMUST00000176191; ENSMUSP00000135071; ENSMUSG00000029088 [Q6PHZ8-2]
ENSMUST00000176978; ENSMUSP00000134758; ENSMUSG00000029088 [Q6PHZ8-4]
GeneIDi80334
KEGGimmu:80334
UCSCiuc033ijo.1 mouse [Q6PHZ8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF305071 mRNA Translation: AAG36976.1
AF453243 mRNA Translation: AAL86766.1
AY647240 mRNA Translation: AAT68466.1
AK039048 mRNA Translation: BAC30218.1
BC051130 mRNA Translation: AAH51130.1
CK618709 mRNA No translation available.
CCDSiCCDS39084.1 [Q6PHZ8-4]
CCDS57341.1 [Q6PHZ8-2]
CCDS57342.1 [Q6PHZ8-1]
RefSeqiNP_001186171.1, NM_001199242.1 [Q6PHZ8-1]
NP_001186172.1, NM_001199243.1 [Q6PHZ8-2]
NP_084541.3, NM_030265.3 [Q6PHZ8-4]
UniGeneiMm.160172

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
3DD4X-ray3.00A56-250[»]
ProteinModelPortaliQ6PHZ8
SMRiQ6PHZ8
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ6PHZ8, 1 interactor
MINTiQ6PHZ8
STRINGi10090.ENSMUSP00000084656

PTM databases

iPTMnetiQ6PHZ8
PhosphoSitePlusiQ6PHZ8

Proteomic databases

PaxDbiQ6PHZ8
PRIDEiQ6PHZ8

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000087395; ENSMUSP00000084656; ENSMUSG00000029088 [Q6PHZ8-1]
ENSMUST00000176191; ENSMUSP00000135071; ENSMUSG00000029088 [Q6PHZ8-2]
ENSMUST00000176978; ENSMUSP00000134758; ENSMUSG00000029088 [Q6PHZ8-4]
GeneIDi80334
KEGGimmu:80334
UCSCiuc033ijo.1 mouse [Q6PHZ8-1]

Organism-specific databases

CTDi80333
MGIiMGI:1933131 Kcnip4

Phylogenomic databases

eggNOGiKOG0044 Eukaryota
COG5126 LUCA
GeneTreeiENSGT00760000118820
HOGENOMiHOG000233019
HOVERGENiHBG108179
InParanoidiQ6PHZ8
OMAiDTVEDEM
OrthoDBiEOG091G11T4
PhylomeDBiQ6PHZ8
TreeFamiTF318560

Enzyme and pathway databases

ReactomeiR-MMU-5576894 Phase 1 - inactivation of fast Na+ channels

Miscellaneous databases

ChiTaRSiKcnip4 mouse
EvolutionaryTraceiQ6PHZ8
PROiPR:Q6PHZ8
SOURCEiSearch...

Gene expression databases

BgeeiENSMUSG00000029088 Expressed in 174 organ(s), highest expression level in cerebellum
CleanExiMM_KCNIP4
ExpressionAtlasiQ6PHZ8 baseline and differential
GenevisibleiQ6PHZ8 MM

Family and domain databases

CDDicd00051 EFh, 2 hits
InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
PfamiView protein in Pfam
PF13499 EF-hand_7, 1 hit
PF13833 EF-hand_8, 1 hit
SMARTiView protein in SMART
SM00054 EFh, 3 hits
SUPFAMiSSF47473 SSF47473, 1 hit
PROSITEiView protein in PROSITE
PS00018 EF_HAND_1, 3 hits
PS50222 EF_HAND_2, 3 hits
ProtoNetiSearch...

Entry informationi

Entry nameiKCIP4_MOUSE
AccessioniPrimary (citable) accession number: Q6PHZ8
Secondary accession number(s): Q6DTJ3
, Q8CAD0, Q8R4I2, Q9EQ01
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 16, 2005
Last sequence update: July 19, 2004
Last modified: November 7, 2018
This is version 116 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again