Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Serine/threonine-protein kinase ULK3

Gene

ULK3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Serine/threonine protein kinase that acts as a regulator of Sonic hedgehog (SHH) signaling and autophagy. Acts as a negative regulator of SHH signaling in the absence of SHH ligand: interacts with SUFU, thereby inactivating the protein kinase activity and preventing phosphorylation of GLI proteins (GLI1, GLI2 and/or GLI3). Positively regulates SHH signaling in the presence of SHH: dissociates from SUFU, autophosphorylates and mediates phosphorylation of GLI2, activating it and promoting its nuclear translocation. Phosphorylates in vitro GLI2, as well as GLI1 and GLI3, although less efficiently. Also acts as a regulator of autophagy: following cellular senescence, able to induce autophagy.3 Publications

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes the interaction between a single amino acid and another chemical entity. Priority is given to the annotation of physiological ligands.<p><a href='/help/binding' target='_top'>More...</a></p>Binding sitei44ATPPROSITE-ProRule annotation1
<p>This subsection of the ‘Function’ section is used for enzymes and indicates the residues directly involved in catalysis.<p><a href='/help/act_site' target='_top'>More...</a></p>Active sitei137Proton acceptorPROSITE-ProRule annotation1

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Function’ section describes a region in the protein which binds nucleotide phosphates. It always involves more than one amino acid and includes all residues involved in nucleotide-binding.<p><a href='/help/np_bind' target='_top'>More...</a></p>Nucleotide bindingi20 – 28ATPPROSITE-ProRule annotation9

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • ATP binding Source: UniProtKB-KW
  • protein serine/threonine kinase activity Source: UniProtKB

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionKinase, Serine/threonine-protein kinase, Transferase
Biological processAutophagy
LigandATP-binding, Nucleotide-binding

Enzyme and pathway databases

BRENDA Comprehensive Enzyme Information System

More...
BRENDAi
2.7.11.1 2681

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-HSA-5632684 Hedgehog 'on' state

SignaLink: a signaling pathway resource with multi-layered regulatory networks

More...
SignaLinki
Q6PHR2

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Serine/threonine-protein kinase ULK3 (EC:2.7.11.1)
Alternative name(s):
Unc-51-like kinase 3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:ULK3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 15

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000140474.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:19703 ULK3

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
613472 gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6PHR2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/manual/pathology_and_biotech_section">'Pathology and Biotech'</a> section describes the effect of the experimental mutation of one or more amino acid(s) on the biological properties of the protein.<p><a href='/help/mutagen' target='_top'>More...</a></p>Mutagenesisi44K → R: Decreased kinase activity. 1 Publication1
Mutagenesisi139K → R: Loss of kinase activity. Does not promote GLI1 nuclear localization. 2 Publications1

Organism-specific databases

DisGeNET

More...
DisGeNETi
25989

Open Targets

More...
OpenTargetsi
ENSG00000140474

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134908392

Chemistry databases

ChEMBL database of bioactive drug-like small molecules

More...
ChEMBLi
CHEMBL5047

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
ULK3

Domain mapping of disease mutations (DMDM)

More...
DMDMi
259016166

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00002501501 – 472Serine/threonine-protein kinase ULK3Add BLAST472

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei176PhosphoserineCombined sources1
Modified residuei300Phosphoserine; by autocatalysis1 Publication1
Modified residuei350Phosphoserine; by autocatalysis1 Publication1
Modified residuei384Phosphoserine; by autocatalysis1 Publication1
Modified residuei464Phosphoserine; by autocatalysis1 Publication1

<p>This subsection of the <a href="http://www.uniprot.org/help/ptm_processing_section">PTM/processing</a> section describes post-translational modifications (PTMs). This subsection <strong>complements</strong> the information provided at the sequence level or describes modifications for which <strong>position-specific data is not yet available</strong>.<p><a href='/help/post-translational_modification' target='_top'>More...</a></p>Post-translational modificationi

Autophosphorylated. Autophosphorylation is blocked by interaction with SUFU.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q6PHR2

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6PHR2

MaxQB - The MaxQuant DataBase

More...
MaxQBi
Q6PHR2

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6PHR2

PeptideAtlas

More...
PeptideAtlasi
Q6PHR2

PRoteomics IDEntifications database

More...
PRIDEi
Q6PHR2

ProteomicsDB human proteome resource

More...
ProteomicsDBi
67125
67126 [Q6PHR2-2]
67127 [Q6PHR2-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6PHR2

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6PHR2

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed. Highest levels observed in fetal brain. In adult tissues, high levels in brain, liver and kidney, moderate levels in testis and adrenal gland and low levels in heart, lung, stomach, thymus, prostate and placenta. In the brain, highest expression in the hippocampus, high levels also detected in the cerebellum, olfactory bulb and optic nerve. In the central nervous system, lowest levels in the spinal cord.1 Publication

<p>This subsection of the ‘Expression’ section reports the experimentally proven effects of inducers and repressors (usually chemical compounds or environmental factors) on the level of protein (or mRNA) expression (up-regulation, down-regulation, constitutive expression).<p><a href='/help/induction' target='_top'>More...</a></p>Inductioni

Up-regulated during senescence.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000140474 Expressed in 189 organ(s), highest expression level in right hemisphere of cerebellum

CleanEx database of gene expression profiles

More...
CleanExi
HS_ULK3

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6PHR2 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6PHR2 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA040474

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts (via protein kinase domain) with SUFU.1 Publication

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
117470, 7 interactors

Protein interaction database and analysis system

More...
IntActi
Q6PHR2, 10 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000400312

Chemistry databases

BindingDB database of measured binding affinities

More...
BindingDBi
Q6PHR2

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

Secondary structure

1472
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details

3D structure databases

Select the link destinations:

Protein Data Bank Europe

More...
PDBei

Protein Data Bank RCSB

More...
RCSB PDBi

Protein Data Bank Japan

More...
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4WZXX-ray1.39A359-449[»]
6FDYX-ray1.70U2-277[»]
6FDZX-ray2.55U2-277[»]

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q6PHR2

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6PHR2

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini14 – 270Protein kinasePROSITE-ProRule annotationAdd BLAST257
Domaini280 – 348MIT 1Add BLAST69
Domaini375 – 444MIT 2Add BLAST70

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the protein kinase superfamily. Ser/Thr protein kinase family. APG1/unc-51/ULK1 subfamily.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG0595 Eukaryota
ENOG410XR01 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00940000157689

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000233016

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG094133

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6PHR2

KEGG Orthology (KO)

More...
KOi
K21358

Identification of Orthologs from Complete Genome Data

More...
OMAi
CSALEHF

Database of Orthologous Groups

More...
OrthoDBi
642235at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6PHR2

TreeFam database of animal gene trees

More...
TreeFami
TF324551

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR007330 MIT
IPR036181 MIT_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR008271 Ser/Thr_kinase_AS

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF04212 MIT, 2 hits
PF00069 Pkinase, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00745 MIT, 2 hits
SM00220 S_TKc, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF116846 SSF116846, 2 hits
SSF56112 SSF56112, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 7 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6PHR2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MAGPGWGPPR LDGFILTERL GSGTYATVYK AYAKKDTREV VAIKCVAKKS
60 70 80 90 100
LNKASVENLL TEIEILKGIR HPHIVQLKDF QWDSDNIYLI MEFCAGGDLS
110 120 130 140 150
RFIHTRRILP EKVARVFMQQ LASALQFLHE RNISHLDLKP QNILLSSLEK
160 170 180 190 200
PHLKLADFGF AQHMSPWDEK HVLRGSPLYM APEMVCQRQY DARVDLWSMG
210 220 230 240 250
VILYEALFGQ PPFASRSFSE LEEKIRSNRV IELPLRPLLS RDCRDLLQRL
260 270 280 290 300
LERDPSRRIS FQDFFAHPWV DLEHMPSGES LGRATALVVQ AVKKDQEGDS
310 320 330 340 350
AAALSLYCKA LDFFVPALHY EVDAQRKEAI KAKVGQYVSR AEELKAIVSS
360 370 380 390 400
SNQALLRQGT SARDLLREMA RDKPRLLAAL EVASAAMAKE EAAGGEQDAL
410 420 430 440 450
DLYQHSLGEL LLLLAAEPPG RRRELLHTEV QNLMARAEYL KEQVKMRESR
460 470
WEADTLDKEG LSESVRSSCT LQ
Length:472
Mass (Da):53,444
Last modified:September 22, 2009 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i11D03E311AF36162
GO
Isoform 2 (identifier: Q6PHR2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     205-214: EALFGQPPFA → GETSFPCFSP
     215-472: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:214
Mass (Da):24,402
Checksum:iB51B24CC2A2A0D0E
GO
Isoform 3 (identifier: Q6PHR2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     444-445: Missing.

Note: May be due to competing donor splice site. No experimental confirmation available.
Show »
Length:470
Mass (Da):53,217
Checksum:iB00A71FDAD785B64
GO
Isoform 4 (identifier: Q6PHR2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-34: MAGPGWGPPRLDGFILTERLGSGTYATVYKAYAK → MQRNGSASRG...ESWEARCWCA

Note: No experimental confirmation available.
Show »
Length:483
Mass (Da):54,997
Checksum:i6987C57ACDD4B6CC
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 7 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
H3BT78H3BT78_HUMAN
Serine/threonine-protein kinase ULK...
ULK3
136Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BPN6H3BPN6_HUMAN
Serine/threonine-protein kinase ULK...
ULK3
84Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BP85H3BP85_HUMAN
Serine/threonine-protein kinase ULK...
ULK3
41Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BS27H3BS27_HUMAN
Serine/threonine-protein kinase ULK...
ULK3
61Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BTS3H3BTS3_HUMAN
Serine/threonine-protein kinase ULK...
ULK3
42Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BMW8H3BMW8_HUMAN
Serine/threonine-protein kinase ULK...
ULK3
50Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
H3BV76H3BV76_HUMAN
Serine/threonine-protein kinase ULK...
ULK3
49Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence CAB55955 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti47A → S in BAG61369 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_057113101R → H. Corresponds to variant dbSNP:rs34945944Ensembl.1
Natural variantiVAR_059771445K → R. Corresponds to variant dbSNP:rs12898397Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0574111 – 34MAGPG…KAYAK → MQRNGSASRGLEKTRLRLCR EARIPESAFLTGLTRESWEA RCWCA in isoform 4. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_038147205 – 214EALFGQPPFA → GETSFPCFSP in isoform 2. 3 Publications10
Alternative sequenceiVSP_038148215 – 472Missing in isoform 2. 3 PublicationsAdd BLAST258
Alternative sequenceiVSP_039925444 – 445Missing in isoform 3. 1 Publication2

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK294245 mRNA Translation: BAG57541.1
AK299380 mRNA Translation: BAG61369.1
AL117482 mRNA Translation: CAB55955.2 Different initiation.
AC091230 Genomic DNA No translation available.
BC036117 mRNA No translation available.
BC056423 mRNA No translation available.
CH471136 Genomic DNA Translation: EAW99301.1
CH471136 Genomic DNA Translation: EAW99303.1
BC157884 mRNA Translation: AAI57885.1
AL360256 mRNA Translation: CAB96176.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS45305.1 [Q6PHR2-1]
CCDS76779.1 [Q6PHR2-3]

Protein sequence database of the Protein Information Resource

More...
PIRi
T17265

NCBI Reference Sequences

More...
RefSeqi
NP_001092906.3, NM_001099436.3 [Q6PHR2-1]
NP_001271293.2, NM_001284364.2 [Q6PHR2-3]
NP_001271294.1, NM_001284365.2
XP_005254346.1, XM_005254289.2 [Q6PHR2-4]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.513034

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000440863; ENSP00000400312; ENSG00000140474 [Q6PHR2-1]
ENST00000568667; ENSP00000457853; ENSG00000140474 [Q6PHR2-4]
ENST00000569437; ENSP00000456051; ENSG00000140474 [Q6PHR2-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
25989

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:25989

UCSC genome browser

More...
UCSCi
uc010ulq.3 human
uc059llp.1 human [Q6PHR2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK294245 mRNA Translation: BAG57541.1
AK299380 mRNA Translation: BAG61369.1
AL117482 mRNA Translation: CAB55955.2 Different initiation.
AC091230 Genomic DNA No translation available.
BC036117 mRNA No translation available.
BC056423 mRNA No translation available.
CH471136 Genomic DNA Translation: EAW99301.1
CH471136 Genomic DNA Translation: EAW99303.1
BC157884 mRNA Translation: AAI57885.1
AL360256 mRNA Translation: CAB96176.1
CCDSiCCDS45305.1 [Q6PHR2-1]
CCDS76779.1 [Q6PHR2-3]
PIRiT17265
RefSeqiNP_001092906.3, NM_001099436.3 [Q6PHR2-1]
NP_001271293.2, NM_001284364.2 [Q6PHR2-3]
NP_001271294.1, NM_001284365.2
XP_005254346.1, XM_005254289.2 [Q6PHR2-4]
UniGeneiHs.513034

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4WZXX-ray1.39A359-449[»]
6FDYX-ray1.70U2-277[»]
6FDZX-ray2.55U2-277[»]
ProteinModelPortaliQ6PHR2
SMRiQ6PHR2
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi117470, 7 interactors
IntActiQ6PHR2, 10 interactors
STRINGi9606.ENSP00000400312

Chemistry databases

BindingDBiQ6PHR2
ChEMBLiCHEMBL5047

PTM databases

iPTMnetiQ6PHR2
PhosphoSitePlusiQ6PHR2

Polymorphism and mutation databases

BioMutaiULK3
DMDMi259016166

Proteomic databases

EPDiQ6PHR2
jPOSTiQ6PHR2
MaxQBiQ6PHR2
PaxDbiQ6PHR2
PeptideAtlasiQ6PHR2
PRIDEiQ6PHR2
ProteomicsDBi67125
67126 [Q6PHR2-2]
67127 [Q6PHR2-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
25989
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000440863; ENSP00000400312; ENSG00000140474 [Q6PHR2-1]
ENST00000568667; ENSP00000457853; ENSG00000140474 [Q6PHR2-4]
ENST00000569437; ENSP00000456051; ENSG00000140474 [Q6PHR2-3]
GeneIDi25989
KEGGihsa:25989
UCSCiuc010ulq.3 human
uc059llp.1 human [Q6PHR2-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
25989
DisGeNETi25989
EuPathDBiHostDB:ENSG00000140474.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
ULK3

H-Invitational Database, human transcriptome db

More...
H-InvDBi
HIX0012431
HGNCiHGNC:19703 ULK3
HPAiHPA040474
MIMi613472 gene
neXtProtiNX_Q6PHR2
OpenTargetsiENSG00000140474
PharmGKBiPA134908392

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG0595 Eukaryota
ENOG410XR01 LUCA
GeneTreeiENSGT00940000157689
HOGENOMiHOG000233016
HOVERGENiHBG094133
InParanoidiQ6PHR2
KOiK21358
OMAiCSALEHF
OrthoDBi642235at2759
PhylomeDBiQ6PHR2
TreeFamiTF324551

Enzyme and pathway databases

BRENDAi2.7.11.1 2681
ReactomeiR-HSA-5632684 Hedgehog 'on' state
SignaLinkiQ6PHR2

Miscellaneous databases

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
ULK3 human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
25989

Protein Ontology

More...
PROi
PR:Q6PHR2

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000140474 Expressed in 189 organ(s), highest expression level in right hemisphere of cerebellum
CleanExiHS_ULK3
ExpressionAtlasiQ6PHR2 baseline and differential
GenevisibleiQ6PHR2 HS

Family and domain databases

InterProiView protein in InterPro
IPR011009 Kinase-like_dom_sf
IPR007330 MIT
IPR036181 MIT_dom_sf
IPR000719 Prot_kinase_dom
IPR017441 Protein_kinase_ATP_BS
IPR008271 Ser/Thr_kinase_AS
PfamiView protein in Pfam
PF04212 MIT, 2 hits
PF00069 Pkinase, 1 hit
SMARTiView protein in SMART
SM00745 MIT, 2 hits
SM00220 S_TKc, 1 hit
SUPFAMiSSF116846 SSF116846, 2 hits
SSF56112 SSF56112, 1 hit
PROSITEiView protein in PROSITE
PS00107 PROTEIN_KINASE_ATP, 1 hit
PS50011 PROTEIN_KINASE_DOM, 1 hit
PS00108 PROTEIN_KINASE_ST, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiULK3_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6PHR2
Secondary accession number(s): B2RXK3
, B4DFT0, B4DRQ7, D3DW68, Q9NPN5, Q9UFS4
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: September 19, 2006
Last sequence update: September 22, 2009
Last modified: January 16, 2019
This is version 144 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human and mouse protein kinases
    Human and mouse protein kinases: classification and index
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  4. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  5. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  6. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  7. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again