Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 133 (07 Apr 2021)
Sequence version 2 (31 Aug 2004)
Previous versions | rss
Add a publicationFeedback
Protein

ERC protein 2

Gene

Erc2

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Thought to be involved in the organization of the cytomatrix at the nerve terminals active zone (CAZ) which regulates neurotransmitter release. Seems to act together with BSN. May recruit liprin-alpha proteins to the CAZ.

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
ERC protein 2
Alternative name(s):
CAZ-associated structural protein 1
Short name:
CAST1
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Erc2
Synonyms:Cast1, D14Ertd171e, Kiaa0378
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 14

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:1098749, Erc2

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Cytoskeleton, Synapse

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00000870031 – 957ERC protein 2Add BLAST957

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei65PhosphoserineCombined sources1
Modified residuei666PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q6PH08

jPOST - Japan Proteome Standard Repository/Database

More...
jPOSTi
Q6PH08

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6PH08

PeptideAtlas

More...
PeptideAtlasi
Q6PH08

PRoteomics IDEntifications database

More...
PRIDEi
Q6PH08

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
275764 [Q6PH08-1]
275765 [Q6PH08-2]
275766 [Q6PH08-3]
275767 [Q6PH08-4]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6PH08

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6PH08

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the 'Expression' section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified 'at protein level'.<br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Expressed throughout the central nervous system, including hippocampus, cortex, cerebellum and olfactory bulb.1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000040640, Expressed in visual cortex and 205 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6PH08, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6PH08, MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction%5Fsection">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function%5Fsection">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with BSN, ERC1, PPFIA1, PPFIA2, PPFIA3 and PPFIA4.

Interacts through its C-terminus with the PDZ domain of RIMS1.

Part of a complex consisting of ERC2, RIMS1 and UNC13A.

GO - Molecular functioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
232032, 13 interactors

Protein interaction database and analysis system

More...
IntActi
Q6PH08, 4 interactors

STRING: functional protein association networks

More...
STRINGi
10090.ENSMUSP00000087773

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q6PH08, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6PH08

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili140 – 917Sequence analysisAdd BLAST778

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and Domains' section describes the position of regions of compositional bias within the protein and the particular amino acids that are over-represented within those regions.<p><a href='/help/compbias' target='_top'>More...</a></p>Compositional biasi35 – 41Poly-Gly7
Compositional biasi129 – 133Poly-His5
Compositional biasi879 – 882Poly-Lys4
Compositional biasi920 – 932Poly-HisAdd BLAST13

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG4809, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00650000093320

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_009304_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6PH08

Identification of Orthologs from Complete Genome Data

More...
OMAi
EEILEMX

Database of Orthologous Groups

More...
OrthoDBi
446752at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6PH08

TreeFam database of animal gene trees

More...
TreeFami
TF324969

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR019323, ELKS/CAST
IPR030625, ERC2

The PANTHER Classification System

More...
PANTHERi
PTHR18861:SF3, PTHR18861:SF3, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF10174, Cast, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 4 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 4 described isoforms and 4 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6PH08-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MYGSARTISN LEGSPSRSPR LPRSPRLGHR RTSSGGGGGT GKTLSMENIQ
60 70 80 90 100
SLNAAYATSG PMYLSDHEGV ASTTYPKGTM TLGRATNRAV YGGRVTAMGS
110 120 130 140 150
SPNIASAGLS HTDVLSYTDQ HGGLSGSSHH HHHQVPSMLR QVRDSTMLDL
160 170 180 190 200
QAQLKELQRE NDLLRKELDI KDSKLGSSMN SIKTFWSPEL KKERVLRKEE
210 220 230 240 250
AARMSVLKEQ MRVSHEENQH LQLTIQALQD ELRTQRDLNH LLQQESGNRG
260 270 280 290 300
AEHFTIELTE ENFRRLQAEH DRQAKELFLL RKTLEEMELR IETQKQTLNA
310 320 330 340 350
RDESIKKLLE MLQSKGLPSK SLEDDNERTR RMAEAESQVS HLEVILDQKE
360 370 380 390 400
KENIHLREEL HRRSQLQPEP AKTKALQTVI EMKDTKIASL ERNIRDLEDE
410 420 430 440 450
VQMLKANGVL NTEDREEEIK QIEVYKSHSK FMKTKIDQLK QELSKKESEL
460 470 480 490 500
LALQTKLETL SNQNSDCKQH IEVLKESLTA KEQRAAILQT EVDALRLRLE
510 520 530 540 550
EKESFLNKKT KQLQDLTEEK GTLAGEIRDM KDMLEVKERK INVLQKKIEN
560 570 580 590 600
LQEQLRDKDK QLTNLKDRVK SLQTDSSNTD TALATLEEAL SEKERIIERL
610 620 630 640 650
KEQRERDDRE RLEEIESFRK ENKDLKEKVN ALQAELTEKE SSLIDLKEHA
660 670 680 690 700
SSLASAGLKR DSKLKSLEIA IEQKKEECNK LEAQLKKAHN IEDDSRMNPE
710 720 730 740 750
FADRLKQLDK EASYYRDECG KAQAEVDRLL EILKEVENEK NDKDKKIAEL
760 770 780 790 800
ESLTLRHMKD QNKKVANLKY NQQLEKKKNA QLLEEVRRRE DSMVDNSQHL
810 820 830 840 850
QIEELMNALE KTRQELDATK ARLASTQQSL AEKEAHLANL RIERRKQLEE
860 870 880 890 900
ILEMKQEALL AAISEKDANI ALLELSASKK KKTQEEVMAL KREKDRLVHQ
910 920 930 940 950
LKQQTQNRMK LMADNYDEDH HHYHHHHHHH HHRSPGRSQH SNHRPSPDQD

DEEGIWA
Length:957
Mass (Da):110,639
Last modified:August 31, 2004 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9476977763320323
GO
Isoform 2 (identifier: Q6PH08-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-325: Missing.
     326-358: NERTRRMAEAESQVSHLEVILDQKEKENIHLRE → MALNRSVQTCFCSKMPCEQQICSH

Show »
Length:623
Mass (Da):72,909
Checksum:iC23DFB38977E9AB5
GO
Isoform 3 (identifier: Q6PH08-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     752-755: Missing.
     950-957: DDEEGIWA → LSEGLDKRIAQHCSSILIIYCSLALLTIHQRRPAVAAGLKGRGVFAFTFLLNSVLLD

Show »
Length:1,002
Mass (Da):115,502
Checksum:i4F50674FD5D36831
GO
Isoform 4 (identifier: Q6PH08-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     219-219: Q → QLLDARRTK
     493-515: DALRLRLEEKESFLNKKTKQLQD → RHLLRYWRAGALSHIQCCSWETS
     516-957: Missing.

Note: Due to intron retention.Curated
Show »
Length:523
Mass (Da):59,709
Checksum:i95058364DC7CCA87
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 4 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
Q3UHT7Q3UHT7_MOUSE
ERC protein 2
Erc2 D14Ertd171e
977Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GS69A0A1B0GS69_MOUSE
ERC protein 2
Erc2
347Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GSU7A0A1B0GSU7_MOUSE
ERC protein 2
Erc2
251Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1B0GSQ8A0A1B0GSQ8_MOUSE
ERC protein 2
Erc2
51Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAC65547 differs from that shown. Reason: Erroneous initiation. Extended N-terminus.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0123061 – 325Missing in isoform 2. CuratedAdd BLAST325
Alternative sequenceiVSP_011466219Q → QLLDARRTK in isoform 4. 1 Publication1
Alternative sequenceiVSP_011467326 – 358NERTR…IHLRE → MALNRSVQTCFCSKMPCEQQ ICSH in isoform 2. CuratedAdd BLAST33
Alternative sequenceiVSP_011468493 – 515DALRL…KQLQD → RHLLRYWRAGALSHIQCCSW ETS in isoform 4. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_011471516 – 957Missing in isoform 4. 1 PublicationAdd BLAST442
Alternative sequenceiVSP_011469752 – 755Missing in isoform 3. 1 Publication4
Alternative sequenceiVSP_011470950 – 957DDEEGIWA → LSEGLDKRIAQHCSSILIIY CSLALLTIHQRRPAVAAGLK GRGVFAFTFLLNSVLLD in isoform 3. 1 Publication8

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK122265 mRNA Translation: BAC65547.1 Different initiation.
AK032385 mRNA Translation: BAC27848.1
BC056760 mRNA Translation: AAH56760.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS26887.1 [Q6PH08-3]

NCBI Reference Sequences

More...
RefSeqi
NP_808482.2, NM_177814.5 [Q6PH08-3]
XP_006519013.1, XM_006518950.3 [Q6PH08-2]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000090302; ENSMUSP00000087773; ENSMUSG00000040640 [Q6PH08-3]
ENSMUST00000210924; ENSMUSP00000147744; ENSMUSG00000040640 [Q6PH08-2]
ENSMUST00000211145; ENSMUSP00000147886; ENSMUSG00000040640 [Q6PH08-1]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
238988

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:238988

UCSC genome browser

More...
UCSCi
uc007sty.1, mouse [Q6PH08-4]
uc007sua.1, mouse [Q6PH08-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK122265 mRNA Translation: BAC65547.1 Different initiation.
AK032385 mRNA Translation: BAC27848.1
BC056760 mRNA Translation: AAH56760.1
CCDSiCCDS26887.1 [Q6PH08-3]
RefSeqiNP_808482.2, NM_177814.5 [Q6PH08-3]
XP_006519013.1, XM_006518950.3 [Q6PH08-2]

3D structure databases

SMRiQ6PH08
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi232032, 13 interactors
IntActiQ6PH08, 4 interactors
STRINGi10090.ENSMUSP00000087773

PTM databases

iPTMnetiQ6PH08
PhosphoSitePlusiQ6PH08

Proteomic databases

EPDiQ6PH08
jPOSTiQ6PH08
PaxDbiQ6PH08
PeptideAtlasiQ6PH08
PRIDEiQ6PH08
ProteomicsDBi275764 [Q6PH08-1]
275765 [Q6PH08-2]
275766 [Q6PH08-3]
275767 [Q6PH08-4]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
46273, 57 antibodies

Genome annotation databases

EnsembliENSMUST00000090302; ENSMUSP00000087773; ENSMUSG00000040640 [Q6PH08-3]
ENSMUST00000210924; ENSMUSP00000147744; ENSMUSG00000040640 [Q6PH08-2]
ENSMUST00000211145; ENSMUSP00000147886; ENSMUSG00000040640 [Q6PH08-1]
GeneIDi238988
KEGGimmu:238988
UCSCiuc007sty.1, mouse [Q6PH08-4]
uc007sua.1, mouse [Q6PH08-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
26059
MGIiMGI:1098749, Erc2

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

eggNOGiKOG4809, Eukaryota
GeneTreeiENSGT00650000093320
HOGENOMiCLU_009304_0_0_1
InParanoidiQ6PH08
OMAiEEILEMX
OrthoDBi446752at2759
PhylomeDBiQ6PH08
TreeFamiTF324969

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
238988, 0 hits in 20 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...
ChiTaRSi
Erc2, mouse

Protein Ontology

More...
PROi
PR:Q6PH08
RNActiQ6PH08, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000040640, Expressed in visual cortex and 205 other tissues
ExpressionAtlasiQ6PH08, baseline and differential
GenevisibleiQ6PH08, MM

Family and domain databases

InterProiView protein in InterPro
IPR019323, ELKS/CAST
IPR030625, ERC2
PANTHERiPTHR18861:SF3, PTHR18861:SF3, 1 hit
PfamiView protein in Pfam
PF10174, Cast, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiERC2_MOUSE
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6PH08
Secondary accession number(s): Q80U20, Q8CCP1
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: August 31, 2004
Last modified: April 7, 2021
This is version 133 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again