Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

tRNA methyltransferase 10 homolog B

Gene

TRMT10B

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

S-adenosyl-L-methionine-dependent guanine N1-methyltransferase that catalyzes the formation of N1-methylguanine at position 9 (m1G9) in tRNAs (PubMed:23042678). Probably not able to catalyze formation of N1-methyladenine at position 9 (m1A9) in tRNAs (PubMed:23042678).1 Publication

<p>This subsection of the <a href="http://www.uniprot.org/help/function_section">Function</a> section describes the catalytic activity of an enzyme, i.e. a chemical reaction that the enzyme catalyzes.<p><a href='/help/catalytic_activity' target='_top'>More...</a></p>Catalytic activityi

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

  • tRNA (guanine(9)-N(1))-methyltransferase activity Source: UniProtKB-EC
  • tRNA (guanine-N1-)-methyltransferase activity Source: CAFA
  • tRNA binding Source: GO_Central

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Molecular functionMethyltransferase, Transferase
LigandS-adenosyl-L-methionine

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
tRNA methyltransferase 10 homolog B (EC:2.1.1.2211 Publication)
Alternative name(s):
RNA (guanine-9-)-methyltransferase domain-containing protein 3
tRNA (guanine(9)-N(1))-methyltransferase TRMT10B
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TRMT10B
Synonyms:RG9MTD3
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 9

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000165275.9

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26454 TRMT10B

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6PF06

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000165275

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA134938884

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TRMT10B

Domain mapping of disease mutations (DMDM)

More...
DMDMi
74749176

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003113211 – 316tRNA methyltransferase 10 homolog BAdd BLAST316

Proteomic databases

Encyclopedia of Proteome Dynamics

More...
EPDi
Q6PF06

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6PF06

PeptideAtlas

More...
PeptideAtlasi
Q6PF06

PRoteomics IDEntifications database

More...
PRIDEi
Q6PF06

ProteomicsDB human proteome resource

More...
ProteomicsDBi
67098
67099 [Q6PF06-2]
67100 [Q6PF06-3]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6PF06

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6PF06

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000165275 Expressed in 105 organ(s), highest expression level in corpus callosum

CleanEx database of gene expression profiles

More...
CleanExi
HS_RG9MTD3

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6PF06 baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6PF06 HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
HPA021800

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
127659, 34 interactors

Protein interaction database and analysis system

More...
IntActi
Q6PF06, 2 interactors

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000297994

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q6PF06

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6PF06

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini113 – 310SAM-dependent MTase TRM10-typePROSITE-ProRule annotationAdd BLAST198

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Family and domains’ section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili73 – 97Sequence analysisAdd BLAST25

<p>This subsection of the ‘Family and domains’ section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the class IV-like SAM-binding methyltransferase superfamily. TRM10 family.PROSITE-ProRule annotation

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
KOG2967 Eukaryota
ENOG4111JE4 LUCA

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063169

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000006897

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG105959

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6PF06

KEGG Orthology (KO)

More...
KOi
K15445

Identification of Orthologs from Complete Genome Data

More...
OMAi
NFHSKIL

Database of Orthologous Groups

More...
OrthoDBi
1396299at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6PF06

TreeFam database of animal gene trees

More...
TreeFami
TF330972

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
3.40.1280.30, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR028564 MT_TRM10-typ
IPR038459 MT_TRM10-typ_sf
IPR007356 tRNA_m1G_MeTrfase_euk
IPR016009 tRNA_MeTrfase_TRMD/TRM10

The PANTHER Classification System

More...
PANTHERi
PTHR13563 PTHR13563, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF01746 tRNA_m1G_MT, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS51675 SAM_MT_TRM10, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (5+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 5 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 5 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6PF06-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MDWKLEGSTQ KVESPVLQGQ EGILEETGED GLPEGFQLLQ IDAEGECQEG
60 70 80 90 100
EILATGSTAW CSKNVQRKQR HWEKIVAAKK SKRKQEKERR KANRAENPGI
110 120 130 140 150
CPQHSKRFLR ALTKDKLLEA KHSGPRLCID LSMTHYMSKK ELSRLAGQIR
160 170 180 190 200
RLYGSNKKAD RPFWICLTGF TTDSPLYEEC VRMNDGFSSY LLDITEEDCF
210 220 230 240 250
SLFPLETLVY LTPDSEHALE DVDLNKVYIL GGLVDESIQK KVTFQKAREY
260 270 280 290 300
SVKTARLPIQ EYMVRNQNGK NYHSEILAIN QVFDILSTYL ETHNWPEALK
310
KGVSSGKGYI LRNSVE
Length:316
Mass (Da):36,124
Last modified:July 5, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:iE65D2C5F89FCB8C5
GO
Isoform 2 (identifier: Q6PF06-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-98: MDWKLEGSTQ...RRKANRAENP → MVL

Note: No experimental confirmation available.
Show »
Length:221
Mass (Da):25,379
Checksum:iBD74B2D3A6F70EEA
GO
Isoform 5 (identifier: Q6PF06-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     141-191: Missing.
     282-290: Missing.

Show »
Length:256
Mass (Da):29,183
Checksum:iCD4E4822D2784591
GO
Isoform 3 (identifier: Q6PF06-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     141-174: ELSRLAGQIRRLYGSNKKADRPFWICLTGFTTDS → VEHPLSLEFLLAMREAQKGTAFRRIWSTPASGIP
     175-316: Missing.

Note: No experimental confirmation available.
Show »
Length:174
Mass (Da):19,721
Checksum:iA7B2FD8ED6038B63
GO
Isoform 4 (identifier: Q6PF06-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-140: Missing.
     282-290: Missing.

Note: No experimental confirmation available.
Show »
Length:229
Mass (Da):25,813
Checksum:iEFF8B82C1995BA30
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
F5H598F5H598_HUMAN
tRNA methyltransferase 10 homolog B
TRMT10B
141Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H380F5H380_HUMAN
tRNA methyltransferase 10 homolog B
TRMT10B
72Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
F5H4N3F5H4N3_HUMAN
tRNA methyltransferase 10 homolog B
TRMT10B
72Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAB71074 differs from that shown. Reason: Erroneous termination at position 317. Translated as stop.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti106K → E in BAC03957 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_037224234V → G. Corresponds to variant dbSNP:rs36023446Ensembl.1
Natural variantiVAR_037225242V → A. Corresponds to variant dbSNP:rs12337034Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting. The information stored in this subsection is used to automatically construct alternative protein sequence(s) for display.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0295191 – 98MDWKL…RAENP → MVL in isoform 2. 1 PublicationAdd BLAST98
Alternative sequenceiVSP_05465263 – 140Missing in isoform 4. 1 PublicationAdd BLAST78
Alternative sequenceiVSP_055735141 – 191Missing in isoform 5. 1 PublicationAdd BLAST51
Alternative sequenceiVSP_029520141 – 174ELSRL…FTTDS → VEHPLSLEFLLAMREAQKGT AFRRIWSTPASGIP in isoform 3. 1 PublicationAdd BLAST34
Alternative sequenceiVSP_029521175 – 316Missing in isoform 3. 1 PublicationAdd BLAST142
Alternative sequenceiVSP_054653282 – 290Missing in isoform 4 and isoform 5. 1 Publication9

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AK056017 mRNA Translation: BAB71074.1 Sequence problems.
AK092718 mRNA Translation: BAC03957.1
AK294219 mRNA Translation: BAH11702.1
AK295733 mRNA Translation: BAH12169.1
AL138752 Genomic DNA No translation available.
AL591470 Genomic DNA No translation available.
CH471071 Genomic DNA Translation: EAW58267.1
CH471071 Genomic DNA Translation: EAW58268.1
CH471071 Genomic DNA Translation: EAW58269.1
BC012175 mRNA Translation: AAH12175.1
BC057774 mRNA Translation: AAH57774.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS43804.1 [Q6PF06-1]
CCDS69598.1 [Q6PF06-5]
CCDS69600.1 [Q6PF06-4]
CCDS69601.1 [Q6PF06-2]

NCBI Reference Sequences

More...
RefSeqi
NP_001273879.1, NM_001286950.1 [Q6PF06-5]
NP_001273880.1, NM_001286951.1 [Q6PF06-2]
NP_001273881.1, NM_001286952.1 [Q6PF06-4]
NP_001273882.1, NM_001286953.1
NP_001273883.1, NM_001286954.1
NP_659401.2, NM_144964.3 [Q6PF06-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Hs.655614

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000297994; ENSP00000297994; ENSG00000165275 [Q6PF06-1]
ENST00000377753; ENSP00000366982; ENSG00000165275 [Q6PF06-4]
ENST00000377754; ENSP00000366983; ENSG00000165275 [Q6PF06-2]
ENST00000488673; ENSP00000437395; ENSG00000165275 [Q6PF06-3]
ENST00000537911; ENSP00000444997; ENSG00000165275 [Q6PF06-5]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
158234

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:158234

UCSC genome browser

More...
UCSCi
uc004aai.5 human [Q6PF06-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK056017 mRNA Translation: BAB71074.1 Sequence problems.
AK092718 mRNA Translation: BAC03957.1
AK294219 mRNA Translation: BAH11702.1
AK295733 mRNA Translation: BAH12169.1
AL138752 Genomic DNA No translation available.
AL591470 Genomic DNA No translation available.
CH471071 Genomic DNA Translation: EAW58267.1
CH471071 Genomic DNA Translation: EAW58268.1
CH471071 Genomic DNA Translation: EAW58269.1
BC012175 mRNA Translation: AAH12175.1
BC057774 mRNA Translation: AAH57774.1
CCDSiCCDS43804.1 [Q6PF06-1]
CCDS69598.1 [Q6PF06-5]
CCDS69600.1 [Q6PF06-4]
CCDS69601.1 [Q6PF06-2]
RefSeqiNP_001273879.1, NM_001286950.1 [Q6PF06-5]
NP_001273880.1, NM_001286951.1 [Q6PF06-2]
NP_001273881.1, NM_001286952.1 [Q6PF06-4]
NP_001273882.1, NM_001286953.1
NP_001273883.1, NM_001286954.1
NP_659401.2, NM_144964.3 [Q6PF06-1]
UniGeneiHs.655614

3D structure databases

ProteinModelPortaliQ6PF06
SMRiQ6PF06
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi127659, 34 interactors
IntActiQ6PF06, 2 interactors
STRINGi9606.ENSP00000297994

PTM databases

iPTMnetiQ6PF06
PhosphoSitePlusiQ6PF06

Polymorphism and mutation databases

BioMutaiTRMT10B
DMDMi74749176

Proteomic databases

EPDiQ6PF06
PaxDbiQ6PF06
PeptideAtlasiQ6PF06
PRIDEiQ6PF06
ProteomicsDBi67098
67099 [Q6PF06-2]
67100 [Q6PF06-3]

Protocols and materials databases

The DNASU plasmid repository

More...
DNASUi
158234
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000297994; ENSP00000297994; ENSG00000165275 [Q6PF06-1]
ENST00000377753; ENSP00000366982; ENSG00000165275 [Q6PF06-4]
ENST00000377754; ENSP00000366983; ENSG00000165275 [Q6PF06-2]
ENST00000488673; ENSP00000437395; ENSG00000165275 [Q6PF06-3]
ENST00000537911; ENSP00000444997; ENSG00000165275 [Q6PF06-5]
GeneIDi158234
KEGGihsa:158234
UCSCiuc004aai.5 human [Q6PF06-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
158234
EuPathDBiHostDB:ENSG00000165275.9

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TRMT10B
HGNCiHGNC:26454 TRMT10B
HPAiHPA021800
neXtProtiNX_Q6PF06
OpenTargetsiENSG00000165275
PharmGKBiPA134938884

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiKOG2967 Eukaryota
ENOG4111JE4 LUCA
GeneTreeiENSGT00530000063169
HOGENOMiHOG000006897
HOVERGENiHBG105959
InParanoidiQ6PF06
KOiK15445
OMAiNFHSKIL
OrthoDBi1396299at2759
PhylomeDBiQ6PF06
TreeFamiTF330972

Miscellaneous databases

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
158234

Protein Ontology

More...
PROi
PR:Q6PF06

Gene expression databases

BgeeiENSG00000165275 Expressed in 105 organ(s), highest expression level in corpus callosum
CleanExiHS_RG9MTD3
ExpressionAtlasiQ6PF06 baseline and differential
GenevisibleiQ6PF06 HS

Family and domain databases

Gene3Di3.40.1280.30, 1 hit
InterProiView protein in InterPro
IPR028564 MT_TRM10-typ
IPR038459 MT_TRM10-typ_sf
IPR007356 tRNA_m1G_MeTrfase_euk
IPR016009 tRNA_MeTrfase_TRMD/TRM10
PANTHERiPTHR13563 PTHR13563, 1 hit
PfamiView protein in Pfam
PF01746 tRNA_m1G_MT, 1 hit
PROSITEiView protein in PROSITE
PS51675 SAM_MT_TRM10, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTM10B_HUMAN
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6PF06
Secondary accession number(s): B7Z216
, B7Z3D3, Q05DJ4, Q5QP83, Q8NAG2, Q96N36
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: November 13, 2007
Last sequence update: July 5, 2004
Last modified: January 16, 2019
This is version 120 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. SIMILARITY comments
    Index of protein domains and families
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. Human chromosome 9
    Human chromosome 9: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again