Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 131 (07 Oct 2020)
Sequence version 2 (20 May 2008)
Previous versions | rss
Add a publicationFeedback
Protein

Tetratricopeptide repeat protein 23-like

Gene

TTC23L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Biological processi

  • response to endoplasmic reticulum stress Source: ParkinsonsUK-UCL

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...
PathwayCommonsi
Q6PF05

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Tetratricopeptide repeat protein 23-like
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:TTC23L
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 5

Organism-specific databases

Eukaryotic Pathogen Database Resources

More...
EuPathDBi
HostDB:ENSG00000205838.12

Human Gene Nomenclature Database

More...
HGNCi
HGNC:26355, TTC23L

Online Mendelian Inheritance in Man (OMIM)

More...
MIMi
616344, gene

neXtProt; the human protein knowledge platform

More...
neXtProti
NX_Q6PF05

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

Open Targets

More...
OpenTargetsi
ENSG00000205838

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...
PharmGKBi
PA162407169

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...
Pharosi
Q6PF05, Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...
BioMutai
TTC23L

Domain mapping of disease mutations (DMDM)

More...
DMDMi
189041194

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003360801 – 361Tetratricopeptide repeat protein 23-likeAdd BLAST361

Proteomic databases

PaxDb, a database of protein abundance averages across all three domains of life

More...
PaxDbi
Q6PF05

PeptideAtlas

More...
PeptideAtlasi
Q6PF05

PRoteomics IDEntifications database

More...
PRIDEi
Q6PF05

ProteomicsDB: a multi-organism proteome resource

More...
ProteomicsDBi
67095 [Q6PF05-1]
67096 [Q6PF05-2]
67097 [Q6PF05-3]

PTM databases

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6PF05

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSG00000205838, Expressed in testis and 137 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...
ExpressionAtlasi
Q6PF05, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6PF05, HS

Organism-specific databases

Human Protein Atlas

More...
HPAi
ENSG00000205838, Tissue enhanced (ductus deferens, testis)

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...
BioGRIDi
127509, 24 interactors

Protein interaction database and analysis system

More...
IntActi
Q6PF05, 26 interactors

Molecular INTeraction database

More...
MINTi
Q6PF05

STRING: functional protein association networks

More...
STRINGi
9606.ENSP00000422188

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...
RNActi
Q6PF05, protein

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6PF05

Database of comparative protein structure models

More...
ModBasei
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Coiled coil

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Family and domains' section denotes the positions of regions of coiled coil within the protein.<p><a href='/help/coiled' target='_top'>More...</a></p>Coiled coili67 – 95Sequence analysisAdd BLAST29
Coiled coili176 – 209Sequence analysisAdd BLAST34
Coiled coili256 – 283Sequence analysisAdd BLAST28

Keywords - Domaini

Coiled coil

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...
eggNOGi
ENOG502QXY0, Eukaryota

Ensembl GeneTree

More...
GeneTreei
ENSGT00530000063847

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
CLU_030458_1_0_1

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6PF05

Identification of Orthologs from Complete Genome Data

More...
OMAi
NQCREAY

Database of Orthologous Groups

More...
OrthoDBi
1014824at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6PF05

TreeFam database of animal gene trees

More...
TreeFami
TF332604

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.40.10, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011990, TPR-like_helical_dom_sf
IPR042621, TTC23/TTC23L

The PANTHER Classification System

More...
PANTHERi
PTHR14485, PTHR14485, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF48452, SSF48452, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (3+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 3 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 3 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6PF05-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MQASPIRIPT VSNDIDWDFC FHMSQQTEIP AHQQTDELYP TGGCGESEEE
60 70 80 90 100
TKAKEKEKAI DCMSHPKEKL AQSQKKVAQL IKEKMNTQAN KELIRCVILS
110 120 130 140 150
RIIFGDHHWK CARALANLAY GYLTLRGLPV QAKKHATSAK NTLLTWKANT
160 170 180 190 200
TSNKEKEEIL EALVKLYYTL GVAWLLQNRG REAYFNLQKA ERNMKELKEL
210 220 230 240 250
YKGGVCELQV SENDLTLALG RASLAIHRLN LALAYFEKAI GDVIAAKGDR
260 270 280 290 300
TSDLISLYEE AAQIEQLRRN HNQAIQYLQQ AHSVCVSLFT EVSPKTAEMS
310 320 330 340 350
ALLAKAYAMS GEAQHRDAVE IYFIRSINAY RATLGSEDFE TLSTTEEFCK
360
WLVQNGEKQD K
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Length:361
Mass (Da):40,837
Last modified:May 20, 2008 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i7CF14641AD301D40
GO
Isoform 2 (identifier: Q6PF05-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     281-287: AHSVCVS → MLLRYIS
     288-361: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.Curated
Show »
Length:287
Mass (Da):32,681
Checksum:i4108DAE482B62BB0
GO
Isoform 3 (identifier: Q6PF05-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     359-361: QDK → QIFQKRRYKHDHKRHEKMFNPISHRGNANENHHTDTRVV

Show »
Length:397
Mass (Da):45,311
Checksum:iB70A83133174F2BF
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
A0A3B3IS63A0A3B3IS63_HUMAN
Tetratricopeptide repeat protein 23...
TTC23L
413Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A1W2PP54A0A1W2PP54_HUMAN
Tetratricopeptide repeat protein 23...
TTC23L
359Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
D6RB54D6RB54_HUMAN
Tetratricopeptide repeat protein 23...
TTC23L
49Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AK097766 differs from that shown. Reason: Frameshift.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti115L → P in BAB71699 (PubMed:14702039).Curated1
Sequence conflicti171G → A in AK097766 (PubMed:14702039).Curated1
Sequence conflicti271H → Y in AAR92152 (Ref. 3) Curated1
Sequence conflicti287S → P in AK097766 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes natural variant(s) of the protein sequence.<p><a href='/help/variant' target='_top'>More...</a></p>Natural variantiVAR_04353922H → R1 PublicationCorresponds to variant dbSNP:rs6451173Ensembl.1
Natural variantiVAR_04354067K → E. Corresponds to variant dbSNP:rs6866035Ensembl.1
Natural variantiVAR_043541150T → M. Corresponds to variant dbSNP:rs34566695Ensembl.1
Natural variantiVAR_043542153N → D. Corresponds to variant dbSNP:rs35769440Ensembl.1
Natural variantiVAR_043543247K → N. Corresponds to variant dbSNP:rs34702907Ensembl.1
Natural variantiVAR_043544325R → K. Corresponds to variant dbSNP:rs35665026Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_033814281 – 287AHSVCVS → MLLRYIS in isoform 2. 1 Publication7
Alternative sequenceiVSP_033815288 – 361Missing in isoform 2. 1 PublicationAdd BLAST74
Alternative sequenceiVSP_033816359 – 361QDK → QIFQKRRYKHDHKRHEKMFN PISHRGNANENHHTDTRVV in isoform 3. 1 Publication3

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
JN799997 mRNA Translation: AER93257.1
AK058168 mRNA Translation: BAB71699.1
AK097766 mRNA No translation available.
AY498865 mRNA Translation: AAR92152.1
AC026801 Genomic DNA No translation available.
BC057775 mRNA Translation: AAH57775.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS54840.1 [Q6PF05-1]

NCBI Reference Sequences

More...
RefSeqi
NP_001304878.1, NM_001317949.1
NP_653326.3, NM_144725.3 [Q6PF05-1]

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENST00000502674; ENSP00000425242; ENSG00000205838 [Q6PF05-2]
ENST00000505624; ENSP00000422188; ENSG00000205838 [Q6PF05-1]
ENST00000610313; ENSP00000484792; ENSG00000205838 [Q6PF05-2]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
153657

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
hsa:153657

UCSC genome browser

More...
UCSCi
uc003jiu.4, human [Q6PF05-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
JN799997 mRNA Translation: AER93257.1
AK058168 mRNA Translation: BAB71699.1
AK097766 mRNA No translation available.
AY498865 mRNA Translation: AAR92152.1
AC026801 Genomic DNA No translation available.
BC057775 mRNA Translation: AAH57775.1
CCDSiCCDS54840.1 [Q6PF05-1]
RefSeqiNP_001304878.1, NM_001317949.1
NP_653326.3, NM_144725.3 [Q6PF05-1]

3D structure databases

SMRiQ6PF05
ModBaseiSearch...

Protein-protein interaction databases

BioGRIDi127509, 24 interactors
IntActiQ6PF05, 26 interactors
MINTiQ6PF05
STRINGi9606.ENSP00000422188

PTM databases

PhosphoSitePlusiQ6PF05

Polymorphism and mutation databases

BioMutaiTTC23L
DMDMi189041194

Proteomic databases

PaxDbiQ6PF05
PeptideAtlasiQ6PF05
PRIDEiQ6PF05
ProteomicsDBi67095 [Q6PF05-1]
67096 [Q6PF05-2]
67097 [Q6PF05-3]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...
Antibodypediai
22823, 64 antibodies

The DNASU plasmid repository

More...
DNASUi
153657

Genome annotation databases

EnsembliENST00000502674; ENSP00000425242; ENSG00000205838 [Q6PF05-2]
ENST00000505624; ENSP00000422188; ENSG00000205838 [Q6PF05-1]
ENST00000610313; ENSP00000484792; ENSG00000205838 [Q6PF05-2]
GeneIDi153657
KEGGihsa:153657
UCSCiuc003jiu.4, human [Q6PF05-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
153657
EuPathDBiHostDB:ENSG00000205838.12

GeneCards: human genes, protein and diseases

More...
GeneCardsi
TTC23L
HGNCiHGNC:26355, TTC23L
HPAiENSG00000205838, Tissue enhanced (ductus deferens, testis)
MIMi616344, gene
neXtProtiNX_Q6PF05
OpenTargetsiENSG00000205838
PharmGKBiPA162407169

GenAtlas: human gene database

More...
GenAtlasi
Search...

Phylogenomic databases

eggNOGiENOG502QXY0, Eukaryota
GeneTreeiENSGT00530000063847
HOGENOMiCLU_030458_1_0_1
InParanoidiQ6PF05
OMAiNQCREAY
OrthoDBi1014824at2759
PhylomeDBiQ6PF05
TreeFamiTF332604

Enzyme and pathway databases

PathwayCommonsiQ6PF05

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...
BioGRID-ORCSi
153657, 5 hits in 873 CRISPR screens

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...
GenomeRNAii
153657
PharosiQ6PF05, Tdark

Protein Ontology

More...
PROi
PR:Q6PF05
RNActiQ6PF05, protein

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSG00000205838, Expressed in testis and 137 other tissues
ExpressionAtlasiQ6PF05, baseline and differential
GenevisibleiQ6PF05, HS

Family and domain databases

Gene3Di1.25.40.10, 1 hit
InterProiView protein in InterPro
IPR011990, TPR-like_helical_dom_sf
IPR042621, TTC23/TTC23L
PANTHERiPTHR14485, PTHR14485, 1 hit
SUPFAMiSSF48452, SSF48452, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiTT23L_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6PF05
Secondary accession number(s): G8IJH6
, Q6RGS4, Q8N7R3, Q96LJ2
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 20, 2008
Last sequence update: May 20, 2008
Last modified: October 7, 2020
This is version 131 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  4. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again