Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Entry version 130 (16 Jan 2019)
Sequence version 1 (05 Jul 2004)
Previous versions | rss
Other tutorials and videosHelp videoFeedback
Protein

Sterile alpha and TIR motif-containing protein 1

Gene

Sarm1

Organism
Mus musculus (Mouse)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the ‘correct annotation’ for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the ‘protein existence’ evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Negative regulator of MYD88- and TRIF-dependent toll-like receptor signaling pathway which plays a pivotal role in activating axonal degeneration following injury. Promotes Wallerian degeneration an injury-induced axonal death pathway which involves degeneration of an axon distal to the injury site. Can activate neuronal death in response to stress. Regulates dendritic arborization through the MAPK4-JNK pathway. Involved in innate immune response. Inhibits both TICAM1/TRIF- and MYD88-dependent activation of JUN/AP-1, TRIF-dependent activation of NF-kappa-B and IRF3, and the phosphorylation of MAPK14/p38. Can restrict West Nile virus (WNV) pathogenesis.4 Publications

<p>The <a href="http://www.geneontology.org/">Gene Ontology (GO)</a> project provides a set of hierarchical controlled vocabulary split into 3 categories:<p><a href='/help/gene_ontology' target='_top'>More...</a></p>GO - Molecular functioni

GO - Biological processi

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywordsi

Biological processDifferentiation, Immunity, Innate immunity, Neurogenesis

Enzyme and pathway databases

Reactome - a knowledgebase of biological pathways and processes

More...
Reactomei
R-MMU-166166 MyD88-independent TLR4 cascade
R-MMU-936964 Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon
R-MMU-937041 IKK complex recruitment mediated by RIP1
R-MMU-937072 TRAF6-mediated induction of TAK1 complex within TLR4 complex

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
Sterile alpha and TIR motif-containing protein 1
Alternative name(s):
Tir-1 homolog
Short name:
MyD88-5
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: ‘Name’, ‘Synonyms’, ‘Ordered locus names’ and ‘ORF names’.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:Sarm1
Synonyms:Kiaa0524
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiMus musculus (Mouse)
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the ‘taxonomic identifier’ or ‘taxid’.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri10090 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresGliresRodentiaMyomorphaMuroideaMuridaeMurinaeMusMus
<p>This subsection of the <a href="http://www.uniprot.org/help/names_and_taxonomy_section">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000000589 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes_manual">proteome</a> can consist of several components. <br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 11

Organism-specific databases

Mouse genome database (MGD) from Mouse Genome Informatics (MGI)

More...
MGIi
MGI:2136419 Sarm1

<p>This section provides information on the location and the topology of the mature protein in the cell.<p><a href='/help/subcellular_location_section' target='_top'>More...</a></p>Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte & Seán O’Donoghue; Source: COMPARTMENTS

Keywords - Cellular componenti

Cell junction, Cell projection, Cytoplasm, Mitochondrion, Synapse

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

<p>This subsection of the ‘Pathology and Biotech’ section describes the in vivo effects caused by ablation of the gene (or one or more transcripts) coding for the protein described in the entry. This includes gene knockout and knockdown, provided experiments have been performed in the context of a whole organism or a specific tissue, and not at the single-cell level.<p><a href='/help/disruption_phenotype' target='_top'>More...</a></p>Disruption phenotypei

Severed Sarm1 null axons are able to persist up to 72 hrs after axotomy, whereas wild-type axons degenerate within 8 hrs. Similarly, axons appear to be protected from degeneration in a sciatic nerve lesion model, lasting up to 14 days compared with 3 days for wild type.1 Publication

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a transit peptide.<p><a href='/help/transit' target='_top'>More...</a></p>Transit peptidei1 – 27MitochondrionBy similarityAdd BLAST27
<p>This subsection of the ‘PTM / Processing’ section describes the extent of a polypeptide chain in the mature protein following processing.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_000009759028 – 724Sterile alpha and TIR motif-containing protein 1Add BLAST697

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘PTM / Processing’ section specifies the position and type of each modified residue excluding <a href="http://www.uniprot.org/manual/lipid">lipids</a>, <a href="http://www.uniprot.org/manual/carbohyd">glycans</a> and <a href="http://www.uniprot.org/manual/crosslnk">protein cross-links</a>.<p><a href='/help/mod_res' target='_top'>More...</a></p>Modified residuei548PhosphoserineCombined sources1
Modified residuei558PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

PeptideAtlas

More...
PeptideAtlasi
Q6PDS3

PRoteomics IDEntifications database

More...
PRIDEi
Q6PDS3

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...
iPTMneti
Q6PDS3

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...
PhosphoSitePlusi
Q6PDS3

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

<p>This subsection of the ‘Expression’ section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms. By default, the information is derived from experiments at the mRNA level, unless specified ‘at protein level’. <br></br>Examples: <a href="http://www.uniprot.org/uniprot/P92958#expression">P92958</a>, <a href="http://www.uniprot.org/uniprot/Q8TDN4#expression">Q8TDN4</a>, <a href="http://www.uniprot.org/uniprot/O14734#expression">O14734</a><p><a href='/help/tissue_specificity' target='_top'>More...</a></p>Tissue specificityi

Widely expressed in the brain and neurons (at protein level).1 Publication

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...
Bgeei
ENSMUSG00000050132 Expressed in 86 organ(s), highest expression level in dorsal root ganglion

Genevisible search portal to normalized and curated expression data from Genevestigator

More...
Genevisiblei
Q6PDS3 MM

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the <a href="http://www.uniprot.org/help/interaction_section">'Interaction'</a> section provides information about the protein quaternary structure and interaction(s) with other proteins or protein complexes (with the exception of physiological receptor-ligand interactions which are annotated in the <a href="http://www.uniprot.org/help/function_section">'Function'</a> section).<p><a href='/help/subunit_structure' target='_top'>More...</a></p>Subunit structurei

Interacts with TICAM1/TRIF and thereby interferes with TICAM1/TRIF function (By similarity). Interacts with SDC2 (via cytoplasmic domain) and MAPK10/JNK3.By similarity2 Publications

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction_section%27">Interaction</a> section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="http://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated on a monthly basis. Each binary interaction is displayed on a separate line.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGrid)

More...
BioGridi
231917, 3 interactors

Protein interaction database and analysis system

More...
IntActi
Q6PDS3, 11 interactors

<p>This section provides information on the tertiary and secondary structure of a protein.<p><a href='/help/structure_section' target='_top'>More...</a></p>Structurei

3D structure databases

Protein Model Portal of the PSI-Nature Structural Biology Knowledgebase

More...
ProteinModelPortali
Q6PDS3

SWISS-MODEL Repository - a database of annotated 3D protein structure models

More...
SMRi
Q6PDS3

Database of comparative protein structure models

More...
ModBasei
Search...

MobiDB: a database of protein disorder and mobility annotations

More...
MobiDBi
Search...

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the <a href="http://www.uniprot.org/help/family_and_domains_section">Family and Domains</a> section describes the position and type of a domain, which is defined as a specific combination of secondary structures organized into a characteristic three-dimensional structure or fold.<p><a href='/help/domain' target='_top'>More...</a></p>Domaini412 – 476SAM 1PROSITE-ProRule annotationAdd BLAST65
Domaini486 – 548SAM 2PROSITE-ProRule annotationAdd BLAST63
Domaini559 – 657TIRAdd BLAST99

Keywords - Domaini

Repeat, Transit peptide

Phylogenomic databases

Ensembl GeneTree

More...
GeneTreei
ENSGT00390000004155

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...
HOGENOMi
HOG000008460

The HOVERGEN Database of Homologous Vertebrate Genes

More...
HOVERGENi
HBG079166

InParanoid: Eukaryotic Ortholog Groups

More...
InParanoidi
Q6PDS3

Identification of Orthologs from Complete Genome Data

More...
OMAi
CEVQTWL

Database of Orthologous Groups

More...
OrthoDBi
206466at2759

Database for complete collections of gene phylogenies

More...
PhylomeDBi
Q6PDS3

TreeFam database of animal gene trees

More...
TreeFami
TF315263

Family and domain databases

Gene3D Structural and Functional Annotation of Protein Families

More...
Gene3Di
1.25.10.10, 1 hit
3.40.50.10140, 1 hit

Integrated resource of protein families, domains and functional sites

More...
InterProi
View protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR001660 SAM
IPR013761 SAM/pointed_sf
IPR039184 SARM1
IPR000157 TIR_dom
IPR035897 Toll_tir_struct_dom_sf

The PANTHER Classification System

More...
PANTHERi
PTHR22998 PTHR22998, 1 hit

Pfam protein domain database

More...
Pfami
View protein in Pfam
PF07647 SAM_2, 2 hits
PF13676 TIR_2, 1 hit

Simple Modular Architecture Research Tool; a protein domain database

More...
SMARTi
View protein in SMART
SM00454 SAM, 2 hits
SM00255 TIR, 1 hit

Superfamily database of structural and functional annotation

More...
SUPFAMi
SSF47769 SSF47769, 2 hits
SSF48371 SSF48371, 1 hit
SSF52200 SSF52200, 1 hit

PROSITE; a protein domain and family database

More...
PROSITEi
View protein in PROSITE
PS50105 SAM_DOMAIN, 2 hits

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence_length">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>.<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (4)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences_section">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> displayed by default in the entry is in its mature form or if it represents the precursor.<p><a href='/help/sequence_processing' target='_top'>More...</a></p>Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 4 <p>This subsection of the ‘Sequence’ section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket
Isoform 1 (identifier: Q6PDS3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MVLTLLFSAY KLCRFFTMSG PRPGADRLTV PGPDRSGGAS PWWAAGGRGS
60 70 80 90 100
REVSPGVGTE VQGALERSLP ELQQALSELK QASAARAVGA GLAEVFQLVE
110 120 130 140 150
EAWLLPAVGR EVAQGLCDAI RLDGGLDLLL RLLQAPELET RVQAARLLEQ
160 170 180 190 200
ILVAENRDRV ARIGLGVILN LAKEREPVEL ARSVAGILEH MFKHSEETCQ
210 220 230 240 250
RLVAAGGLDA VLYWCRRTDP ALLRHCALAL ANCALHGGQT VQRCMVEKRA
260 270 280 290 300
AEWLFPLAFS KEDELLRLHA CLAVAVLATN KEVEREVEHS GTLALVEPLV
310 320 330 340 350
ASLDPGRFAR CLVDASDTSQ GRGPDDLQSL VLLLDSSRLE AQCIGAFYLC
360 370 380 390 400
AEAAIKSLQG KTKVFSDIGA IQSLKRLVSY STNGTTSALA KRALRLLGEE
410 420 430 440 450
VPRRILPCVA SWKEAEVQTW LQQIGFSQYC ENFREQQVDG DLLLRLTDEE
460 470 480 490 500
LQTDLGMKSS ITRKRFFREL TELKTFASYA TCDRSNLADW LGSLDPRFRQ
510 520 530 540 550
YTYGLVSCGL DRSLLHRVSE QQLLEDCGIR LGVHRTRILS AAREMLHSPL
560 570 580 590 600
PCTGGKLSGD TPDVFISYRR NSGSQLASLL KVHLQLHGFS VFIDVEKLEA
610 620 630 640 650
GKFEDKLIQS VIAARNFVLV LSAGALDKCM QDHDCKDWVH KEIVTALSCG
660 670 680 690 700
KNIVPIIDGF EWPEPQALPE DMQAVLTFNG IKWSHEYQEA TIEKIIRFLQ
710 720
GRPSQDSSAG SDTSLEGATP MGLP
Length:724
Mass (Da):79,606
Last modified:July 5, 2004 - v1
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i9A5BF03ED22E6102
GO
Isoform 2 (identifier: Q6PDS3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     435-439: Missing.

Note: No experimental confirmation available.
Show »
Length:719
Mass (Da):79,007
Checksum:i08843BA13C0DD69F
GO
Isoform 3 (identifier: Q6PDS3-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     543-543: R → RGHFAQTGLRSLRRPSLHDDGPRDKQWGRATLTSMSLSLAP

Show »
Length:764
Mass (Da):84,006
Checksum:iD76542F538604CF8
GO
Isoform 4 (identifier: Q6PDS3-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-536: Missing.
     537-543: RILSAAR → MSLSLAP

Note: No experimental confirmation available.
Show »
Length:188
Mass (Da):20,594
Checksum:i35C1A626B521791D
GO

<p>This subsection of the ‘Sequence’ section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence BAD32242 differs from that shown. Reason: Erroneous initiation.Curated
The sequence CAI25546 differs from that shown. Reason: Erroneous gene model prediction.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section reports difference(s) between the canonical sequence (displayed by default in the entry) and the different sequence submissions merged in the entry. These various submissions may originate from different sequencing projects, different types of experiments, or different biological samples. Sequence conflicts are usually of unknown origin.<p><a href='/help/conflict' target='_top'>More...</a></p>Sequence conflicti61V → A in AAR17521 (Ref. 1) Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the ‘Sequence’ section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_0136061 – 536Missing in isoform 4. CuratedAdd BLAST536
Alternative sequenceiVSP_013604435 – 439Missing in isoform 2. 1 Publication5
Alternative sequenceiVSP_013607537 – 543RILSAAR → MSLSLAP in isoform 4. Curated7
Alternative sequenceiVSP_013605543R → RGHFAQTGLRSLRRPSLHDD GPRDKQWGRATLTSMSLSLA P in isoform 3. 1 Publication1

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...
EMBLi

GenBank nucleotide sequence database

More...
GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...
DDBJi
Links Updated
AY444167 mRNA Translation: AAR17521.1
AK172964 Transcribed RNA Translation: BAD32242.1 Different initiation.
AK044113 mRNA Translation: BAC31784.1
AL591177 Genomic DNA Translation: CAI25544.1
AL591177 Genomic DNA Translation: CAI25545.1
AL591177 Genomic DNA Translation: CAI25546.1 Sequence problems.
BC058534 mRNA Translation: AAH58534.1
BC080850 mRNA Translation: AAH80850.1

The Consensus CDS (CCDS) project

More...
CCDSi
CCDS25105.1 [Q6PDS3-1]
CCDS48857.1 [Q6PDS3-3]

NCBI Reference Sequences

More...
RefSeqi
NP_001161993.1, NM_001168521.1 [Q6PDS3-3]
NP_766383.2, NM_172795.3 [Q6PDS3-1]

UniGene gene-oriented nucleotide sequence clusters

More...
UniGenei
Mm.210332

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...
Ensembli
ENSMUST00000061174; ENSMUSP00000051059; ENSMUSG00000050132 [Q6PDS3-1]
ENSMUST00000108287; ENSMUSP00000103922; ENSMUSG00000050132 [Q6PDS3-3]

Database of genes from NCBI RefSeq genomes

More...
GeneIDi
237868

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...
KEGGi
mmu:237868

UCSC genome browser

More...
UCSCi
uc007kjh.2 mouse [Q6PDS3-4]
uc007kji.2 mouse [Q6PDS3-1]
uc007kjj.2 mouse [Q6PDS3-3]

Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY444167 mRNA Translation: AAR17521.1
AK172964 Transcribed RNA Translation: BAD32242.1 Different initiation.
AK044113 mRNA Translation: BAC31784.1
AL591177 Genomic DNA Translation: CAI25544.1
AL591177 Genomic DNA Translation: CAI25545.1
AL591177 Genomic DNA Translation: CAI25546.1 Sequence problems.
BC058534 mRNA Translation: AAH58534.1
BC080850 mRNA Translation: AAH80850.1
CCDSiCCDS25105.1 [Q6PDS3-1]
CCDS48857.1 [Q6PDS3-3]
RefSeqiNP_001161993.1, NM_001168521.1 [Q6PDS3-3]
NP_766383.2, NM_172795.3 [Q6PDS3-1]
UniGeneiMm.210332

3D structure databases

ProteinModelPortaliQ6PDS3
SMRiQ6PDS3
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi231917, 3 interactors
IntActiQ6PDS3, 11 interactors

PTM databases

iPTMnetiQ6PDS3
PhosphoSitePlusiQ6PDS3

Proteomic databases

PeptideAtlasiQ6PDS3
PRIDEiQ6PDS3

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENSMUST00000061174; ENSMUSP00000051059; ENSMUSG00000050132 [Q6PDS3-1]
ENSMUST00000108287; ENSMUSP00000103922; ENSMUSG00000050132 [Q6PDS3-3]
GeneIDi237868
KEGGimmu:237868
UCSCiuc007kjh.2 mouse [Q6PDS3-4]
uc007kji.2 mouse [Q6PDS3-1]
uc007kjj.2 mouse [Q6PDS3-3]

Organism-specific databases

Comparative Toxicogenomics Database

More...
CTDi
23098
MGIiMGI:2136419 Sarm1

Rodent Unidentified Gene-Encoded large proteins database

More...
Rougei
Search...

Phylogenomic databases

GeneTreeiENSGT00390000004155
HOGENOMiHOG000008460
HOVERGENiHBG079166
InParanoidiQ6PDS3
OMAiCEVQTWL
OrthoDBi206466at2759
PhylomeDBiQ6PDS3
TreeFamiTF315263

Enzyme and pathway databases

ReactomeiR-MMU-166166 MyD88-independent TLR4 cascade
R-MMU-936964 Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon
R-MMU-937041 IKK complex recruitment mediated by RIP1
R-MMU-937072 TRAF6-mediated induction of TAK1 complex within TLR4 complex

Miscellaneous databases

Protein Ontology

More...
PROi
PR:Q6PDS3

The Stanford Online Universal Resource for Clones and ESTs

More...
SOURCEi
Search...

Gene expression databases

BgeeiENSMUSG00000050132 Expressed in 86 organ(s), highest expression level in dorsal root ganglion
GenevisibleiQ6PDS3 MM

Family and domain databases

Gene3Di1.25.10.10, 1 hit
3.40.50.10140, 1 hit
InterProiView protein in InterPro
IPR011989 ARM-like
IPR016024 ARM-type_fold
IPR001660 SAM
IPR013761 SAM/pointed_sf
IPR039184 SARM1
IPR000157 TIR_dom
IPR035897 Toll_tir_struct_dom_sf
PANTHERiPTHR22998 PTHR22998, 1 hit
PfamiView protein in Pfam
PF07647 SAM_2, 2 hits
PF13676 TIR_2, 1 hit
SMARTiView protein in SMART
SM00454 SAM, 2 hits
SM00255 TIR, 1 hit
SUPFAMiSSF47769 SSF47769, 2 hits
SSF48371 SSF48371, 1 hit
SSF52200 SSF52200, 1 hit
PROSITEiView protein in PROSITE
PS50105 SAM_DOMAIN, 2 hits

ProtoNet; Automatic hierarchical classification of proteins

More...
ProtoNeti
Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the ‘Entry information’ section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiSARM1_MOUSE
<p>This subsection of the ‘Entry information’ section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called ‘Primary (citable) accession number’.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6PDS3
Secondary accession number(s): Q5SYG5
, Q5SYG6, Q6A054, Q6SZW0, Q8BRI9
<p>This subsection of the ‘Entry information’ section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification (‘Last modified’). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical_and_isoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 10, 2005
Last sequence update: July 5, 2004
Last modified: January 16, 2019
This is version 130 of the entry and version 1 of the sequence. See complete history.
<p>This subsection of the ‘Entry information’ section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program

<p>This section contains any relevant information that doesn’t fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. MGD cross-references
    Mouse Genome Database (MGD) cross-references in UniProtKB/Swiss-Prot
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again