Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

UniProtKB - Q6P5X5 (CV039_HUMAN)

Entry version 128 (02 Dec 2020)
Sequence version 2 (29 May 2013)
Previous versions | rss
Add a publicationFeedback
Protein

UPF0545 protein C22orf39

Gene

C22orf39

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score:

Annotation score:5 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>-Experimental evidence at protein leveli <p>This indicates the type of evidence that supports the existence of the protein. Note that the 'protein existence' evidence does not give information on the accuracy or correctness of the sequence(s) displayed.<p><a href='/help/protein_existence' target='_top'>More...</a></p>

<p>This section provides any useful information about the protein, mostly biological knowledge.<p><a href='/help/function_section' target='_top'>More...</a></p>Functioni

Caution

It is uncertain whether Met-1 or Met-38 is the initiator. Orthologous sequences cannot be extended.Curated

Enzyme and pathway databases

Pathway Commons web resource for biological pathway data

More...PathwayCommonsi		Q6P5X5

<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Names & Taxonomyi

<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides an exhaustive list of all names of the protein, from commonly used to obsolete, to allow unambiguous identification of a protein.<p><a href='/help/protein_names' target='_top'>More...</a></p>Protein namesi
Recommended name:
UPF0545 protein C22orf39
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section indicates the name(s) of the gene(s) that code for the protein sequence(s) described in the entry. Four distinct tokens exist: 'Name', 'Synonyms', 'Ordered locus names' and 'ORF names'.<p><a href='/help/gene_name' target='_top'>More...</a></p>Gene namesi
Name:C22orf39
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section provides information on the name(s) of the organism that is the source of the protein sequence.<p><a href='/help/organism-name' target='_top'>More...</a></p>OrganismiHomo sapiens (Human)
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section shows the unique identifier assigned by the NCBI to the source organism of the protein. This is known as the 'taxonomic identifier' or 'taxid'.<p><a href='/help/taxonomic_identifier' target='_top'>More...</a></p>Taxonomic identifieri9606 [NCBI]
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section contains the taxonomic hierarchical classification lineage of the source organism. It lists the nodes as they appear top-down in the taxonomic tree, with the more general grouping listed first.<p><a href='/help/taxonomic_lineage' target='_top'>More...</a></p>Taxonomic lineageiEukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo
<p>This subsection of the <a href="http://www.uniprot.org/help/names%5Fand%5Ftaxonomy%5Fsection">Names and taxonomy</a> section is present for entries that are part of a <a href="http://www.uniprot.org/proteomes">proteome</a>, i.e. of a set of proteins thought to be expressed by organisms whose genomes have been completely sequenced.<p><a href='/help/proteomes_manual' target='_top'>More...</a></p>Proteomesi
  • UP000005640 <p>A UniProt <a href="http://www.uniprot.org/manual/proteomes%5Fmanual">proteome</a> can consist of several components.<br></br>The component name refers to the genomic component encoding a set of proteins.<p><a href='/help/proteome_component' target='_top'>More...</a></p> Componenti: Chromosome 22

Organism-specific databases

Eukaryotic Pathogen and Host Database Resources

More...EuPathDBi		HostDB:ENSG00000242259.8

Human Gene Nomenclature Database

More...HGNCi		HGNC:27012, C22orf39

neXtProt; the human protein knowledge platform

More...neXtProti		NX_Q6P5X5

<p>This section provides information on the disease(s) and phenotype(s) associated with a protein.<p><a href='/help/pathology_and_biotech_section' target='_top'>More...</a></p>Pathology & Biotechi

Organism-specific databases

DisGeNET

More...DisGeNETi		128977

Open Targets

More...OpenTargetsi		ENSG00000242259

The Pharmacogenetics and Pharmacogenomics Knowledge Base

More...PharmGKBi		PA162378995

Miscellaneous databases

Pharos NIH Druggable Genome Knowledgebase

More...Pharosi		Q6P5X5, Tdark

Polymorphism and mutation databases

BioMuta curated single-nucleotide variation and disease association database

More...BioMutai		C22orf39

Domain mapping of disease mutations (DMDM)

More...DMDMi		510120816

<p>This section describes post-translational modifications (PTMs) and/or processing events.<p><a href='/help/ptm_processing_section' target='_top'>More...</a></p>PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'PTM / Processing' section describes the extent of a polypeptide chain in the mature protein following processing or proteolytic cleavage.<p><a href='/help/chain' target='_top'>More...</a></p>ChainiPRO_00003261301 – 142UPF0545 protein C22orf39Add BLAST142

Proteomic databases

Encyclopedia of Proteome Dynamics

More...EPDi		Q6P5X5

MassIVE - Mass Spectrometry Interactive Virtual Environment

More...MassIVEi		Q6P5X5

MaxQB - The MaxQuant DataBase

More...MaxQBi		Q6P5X5

PaxDb, a database of protein abundance averages across all three domains of life

More...PaxDbi		Q6P5X5

PeptideAtlas

More...PeptideAtlasi		Q6P5X5

PRoteomics IDEntifications database

More...PRIDEi		Q6P5X5

ProteomicsDB: a multi-organism proteome resource

More...ProteomicsDBi		26215
67009 [Q6P5X5-1]

PTM databases

iPTMnet integrated resource for PTMs in systems biology context

More...iPTMneti		Q6P5X5

Comprehensive resource for the study of protein post-translational modifications (PTMs) in human, mouse and rat.

More...PhosphoSitePlusi		Q6P5X5

<p>This section provides information on the expression of a gene at the mRNA or protein level in cells or in tissues of multicellular organisms.<p><a href='/help/expression_section' target='_top'>More...</a></p>Expressioni

Gene expression databases

Bgee dataBase for Gene Expression Evolution

More...Bgeei		ENSG00000242259, Expressed in gastrocnemius and 212 other tissues

ExpressionAtlas, Differential and Baseline Expression

More...ExpressionAtlasi		Q6P5X5, baseline and differential

Genevisible search portal to normalized and curated expression data from Genevestigator

More...Genevisiblei		Q6P5X5, HS

Organism-specific databases

Human Protein Atlas

More...HPAi		ENSG00000242259, Low tissue specificity

<p>This section provides information on the quaternary structure of a protein and on interaction(s) with other proteins or protein complexes.<p><a href='/help/interaction_section' target='_top'>More...</a></p>Interactioni

<p>This subsection of the '<a href="http://www.uniprot.org/help/interaction%5Fsection">Interaction</a>' section provides information about binary protein-protein interactions. The data presented in this section are a quality-filtered subset of binary interactions automatically derived from the <a href="https://www.ebi.ac.uk/intact/">IntAct database</a>. It is updated at every <a href="http://www.uniprot.org/help/synchronization">UniProt release</a>.<p><a href='/help/binary_interactions' target='_top'>More...</a></p>Binary interactionsi

Hide details
Q6P5X5
With#Exp.IntAct
ANKS1A [Q49AR9]3EBI-7317823,EBI-11954519
ARSA [P15289]3EBI-7317823,EBI-2117357
BANP [Q8N9N5]3EBI-7317823,EBI-744695
CABP2 [Q9NPB3]3EBI-7317823,EBI-12011224
CEP76 [Q8TAP6]6EBI-7317823,EBI-742887
COL8A1 [P27658]3EBI-7317823,EBI-747133
CRYBA2 [P53672]3EBI-7317823,EBI-750444
CYSRT1 [A8MQ03]6EBI-7317823,EBI-3867333
DTX2 [Q86UW9]5EBI-7317823,EBI-740376
EXOSC8 [Q96B26]3EBI-7317823,EBI-371922
FRS3 [O43559]3EBI-7317823,EBI-725515
GNE - isoform 2 [Q9Y223-2]3EBI-7317823,EBI-11975289
GRN [P28799]3EBI-7317823,EBI-747754
HSD3B7 [Q9H2F3]3EBI-7317823,EBI-3918847
ID2 [Q02363]3EBI-7317823,EBI-713450
ID3 [Q02535]3EBI-7317823,EBI-1387094
INCA1 [Q0VD86]3EBI-7317823,EBI-6509505
KRTAP10-11 [P60412]3EBI-7317823,EBI-10217483
KRTAP10-8 [P60410]5EBI-7317823,EBI-10171774
KRTAP10-9 [P60411]3EBI-7317823,EBI-10172052
KRTAP12-3 [P60328]3EBI-7317823,EBI-11953334
KRTAP13-2 [Q52LG2]3EBI-7317823,EBI-11953846
KRTAP5-6 [Q6L8G9]3EBI-7317823,EBI-10250562
KRTAP9-2 [Q9BYQ4]3EBI-7317823,EBI-1044640
MAGEA11 [P43364]3EBI-7317823,EBI-739552
MDFI [Q99750]3EBI-7317823,EBI-724076
NFATC2IP - isoform 2 [Q8NCF5-2]5EBI-7317823,EBI-12305293
PCSK5 - isoform PC6A [Q92824-2]3EBI-7317823,EBI-11956269
PFDN5 [Q99471]3EBI-7317823,EBI-357275
PLSCR3 [Q9NRY6]3EBI-7317823,EBI-750734
PSMA1 [P25786]3EBI-7317823,EBI-359352
RBPMS [Q93062]3EBI-7317823,EBI-740322
RECK [Q6P9E2]3EBI-7317823,EBI-10253121
RIMBP3 [Q9UFD9]3EBI-7317823,EBI-10182375
SNX32 [Q86XE0]3EBI-7317823,EBI-8099743
TNS2 [Q63HR2]3EBI-7317823,EBI-949753
TRIB3 [Q96RU7]3EBI-7317823,EBI-492476
VWC2L [B2RUY7]5EBI-7317823,EBI-11747707
ZNF620 [Q6ZNG0]3EBI-7317823,EBI-4395669

Protein-protein interaction databases

The Biological General Repository for Interaction Datasets (BioGRID)

More...BioGRIDi		126177, 45 interactors

Protein interaction database and analysis system

More...IntActi		Q6P5X5, 41 interactors

Molecular INTeraction database

More...MINTi		Q6P5X5

STRING: functional protein association networks

More...STRINGi		9606.ENSP00000382474

Miscellaneous databases

RNAct, Protein-RNA interaction predictions for model organisms.

More...RNActi		Q6P5X5, protein

<p>This section provides information on sequence similarities with other proteins and the domain(s) present in a protein.<p><a href='/help/family_and_domains_section' target='_top'>More...</a></p>Family & Domainsi

<p>This subsection of the 'Family and domains' section provides information about the sequence similarity with other proteins.<p><a href='/help/sequence_similarities' target='_top'>More...</a></p>Sequence similaritiesi

Belongs to the UPF0545 family.Curated

Phylogenomic databases

evolutionary genealogy of genes: Non-supervised Orthologous Groups

More...eggNOGi		ENOG502S4W2, Eukaryota

Ensembl GeneTree

More...GeneTreei		ENSGT00390000002511

The HOGENOM Database of Homologous Genes from Fully Sequenced Organisms

More...HOGENOMi		CLU_2164004_0_0_1

InParanoid: Eukaryotic Ortholog Groups

More...InParanoidi		Q6P5X5

Identification of Orthologs from Complete Genome Data

More...OMAi		PRPCETY

Database of Orthologous Groups

More...OrthoDBi		1541651at2759

Database for complete collections of gene phylogenies

More...PhylomeDBi		Q6P5X5

TreeFam database of animal gene trees

More...TreeFami		TF324380

Family and domain databases

Integrated resource of protein families, domains and functional sites

More...InterProi		View protein in InterPro
IPR021475, DUF3128

The PANTHER Classification System

More...PANTHERi		PTHR28052, PTHR28052, 1 hit

Pfam protein domain database

More...Pfami		View protein in Pfam
PF11326, DUF3128, 1 hit

<p>This section displays by default the canonical protein sequence and upon request all isoforms described in the entry. It also includes information pertinent to the sequence(s), including <a href="http://www.uniprot.org/help/sequence%5Flength">length</a> and <a href="http://www.uniprot.org/help/sequences">molecular weight</a>. The information is filed in different subsections. The current subsections and their content are listed below:<p><a href='/help/sequences_section' target='_top'>More...</a></p>Sequences (2+)i

<p>This subsection of the <a href="http://www.uniprot.org/help/sequences%5Fsection">Sequence</a> section indicates if the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> displayed by default in the entry is complete or not.<p><a href='/help/sequence_status' target='_top'>More...</a></p>Sequence statusi: Complete.

This entry describes 2 <p>This subsection of the 'Sequence' section lists the alternative protein sequences (isoforms) that can be generated from the same gene by a single or by the combination of up to four biological events (alternative promoter usage, alternative splicing, alternative initiation and ribosomal frameshifting). Additionally, this section gives relevant information on each alternative protein isoform. This section is only present in reviewed entries, i.e. in UniProtKB/Swiss-Prot.<p><a href='/help/alternative_products' target='_top'>More...</a></p> isoformsi produced by alternative splicing. AlignAdd to basket

This entry has 2 described isoforms and 3 potential isoforms that are computationally mapped.Show allAlign All

Isoform 1 (identifier: Q6P5X5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the <div> <p><b>What is the canonical sequence?</b><p><a href='/help/canonical_and_isoforms' target='_top'>More...</a></p>canonicali sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide
        10         20         30         40         50
MCRCSLVLLS VDHEVPFSSF FIGWRTEGRA WRAGRPDMAD GSGWQPPRPC 
        60         70         80         90        100
EAYRAEWKLC RSARHFLHHY YVHGERPACE QWQRDLASCR DWEERRNAEA 
       110        120        130        140 
QQSLCESERA RVRAARKHIL VWAPRQSPPP DWHLPLPQEK DE
Length:142
Mass (Da):16,805
Last modified:May 29, 2013 - v2
<p>The checksum is a form of redundancy check that is calculated from the sequence. It is useful for tracking sequence updates.</p> <p>It should be noted that while, in theory, two different sequences could have the same checksum value, the likelihood that this would happen is extremely low.</p> <p>However UniProtKB may contain entries with identical sequences in case of multiple genes (paralogs).</p> <p>The checksum is computed as the sequence 64-bit Cyclic Redundancy Check value (CRC64) using the generator polynomial: x<sup>64</sup> + x<sup>4</sup> + x<sup>3</sup> + x + 1. The algorithm is described in the ISO 3309 standard. </p> <p class="publication">Press W.H., Flannery B.P., Teukolsky S.A. and Vetterling W.T.<br /> <strong>Cyclic redundancy and other checksums</strong><br /> <a href="http://www.nrbook.com/b/bookcpdf.php">Numerical recipes in C 2nd ed., pp896-902, Cambridge University Press (1993)</a>)</p> Checksum:i1FA5A0AAE4CD6EDD
GO
Isoform 2 (identifier: Q6P5X5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     102-142: QSLCESERARVRAARKHILVWAPRQSPPPDWHLPLPQEKDE → VLSVVAHTCNLSYLGG

Show »
Length:117
Mass (Da):13,609
Checksum:i4C6B29CC50212B54
GO

<p>In eukaryotic reference proteomes, unreviewed entries that are likely to belong to the same gene are computationally mapped, based on gene identifiers from Ensembl, EnsemblGenomes and model organism databases.<p><a href='/help/gene_centric_isoform_mapping' target='_top'>More...</a></p>Computationally mapped potential isoform sequencesi

There are 3 potential isoforms mapped to this entry.BLASTAlignShow allAdd to basket
EntryEntry nameProtein names
Gene namesLengthAnnotation
E0CX16E0CX16_HUMAN
UPF0545 protein C22orf39
C22orf39
92Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A0C4DH14A0A0C4DH14_HUMAN
UPF0545 protein C22orf39
C22orf39
105Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>
A0A075B6P1A0A075B6P1_HUMAN
UPF0545 protein C22orf39
C22orf39
80Annotation score:

Annotation score:1 out of 5

<p>The annotation score provides a heuristic measure of the annotation content of a UniProtKB entry or proteome. This score <strong>cannot</strong> be used as a measure of the accuracy of the annotation as we cannot define the 'correct annotation' for any given protein.<p><a href='/help/annotation_score' target='_top'>More...</a></p>

<p>This subsection of the 'Sequence' section reports difference(s) between the protein sequence shown in the UniProtKB entry and other available protein sequences derived from the same gene.<p><a href='/help/sequence_caution' target='_top'>More...</a></p>Sequence cautioni

The sequence AAH62599 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence BAF82762 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence CAG30225 differs from that shown. Reason: Erroneous initiation. Truncated N-terminus.Curated
The sequence EAX03040 differs from that shown. Reason: Erroneous gene model prediction.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
<p>This subsection of the 'Sequence' section describes the sequence of naturally occurring alternative protein isoform(s). The changes in the amino acid sequence may be due to alternative splicing, alternative promoter usage, alternative initiation, or ribosomal frameshifting.<p><a href='/help/var_seq' target='_top'>More...</a></p>Alternative sequenceiVSP_046502102 – 142QSLCE…QEKDE → VLSVVAHTCNLSYLGG in isoform 2. CuratedAdd BLAST41

Sequence databases

Select the link destinations:

EMBL nucleotide sequence database

More...EMBLi

GenBank nucleotide sequence database

More...GenBanki

DNA Data Bank of Japan; a nucleotide sequence database

More...DDBJi
Links Updated
AK290073 mRNA Translation: BAF82762.1 Different initiation.
AC000068 Genomic DNA No translation available.
AC000079 Genomic DNA No translation available.
AC000085 Genomic DNA No translation available.
AC000092 Genomic DNA No translation available.
CH471176 Genomic DNA Translation: EAX03039.1
CH471176 Genomic DNA Translation: EAX03040.1 Sequence problems.
CH471176 Genomic DNA Translation: EAX03041.1
BC062599 mRNA Translation: AAH62599.1 Different initiation.
CR456339 mRNA Translation: CAG30225.1 Different initiation.

NCBI Reference Sequences

More...RefSeqi		NP_001159714.1, NM_001166242.1
NP_776154.3, NM_173793.4

Genome annotation databases

Ensembl eukaryotic genome annotation project

More...Ensembli		ENST00000399562; ENSP00000382474; ENSG00000242259 [Q6P5X5-1]
ENST00000542103; ENSP00000439212; ENSG00000242259 [Q6P5X5-2]
ENST00000611555; ENSP00000479673; ENSG00000242259 [Q6P5X5-1]

Database of genes from NCBI RefSeq genomes

More...GeneIDi		128977

KEGG: Kyoto Encyclopedia of Genes and Genomes

More...KEGGi		hsa:128977

UCSC genome browser

More...UCSCi		uc002zpi.4, human [Q6P5X5-1]

<p>UniProtKB Keywords constitute a <a href="http://www.uniprot.org/keywords">controlled vocabulary</a> with a hierarchical structure. Keywords summarise the content of a UniProtKB entry and facilitate the search for proteins of interest.<p><a href='/help/keywords' target='_top'>More...</a></p>Keywords - Coding sequence diversityi

Alternative splicing

<p>This section provides links to proteins that are similar to the protein sequence(s) described in this entry at different levels of sequence identity thresholds (100%, 90% and 50%) based on their membership in UniProt Reference Clusters (<a href="http://www.uniprot.org/help/uniref">UniRef</a>).<p><a href='/help/similar_proteins_section' target='_top'>More...</a></p>Similar proteinsi

<p>This section is used to point to information related to entries and found in data collections other than UniProtKB.<p><a href='/help/cross_references_section' target='_top'>More...</a></p>Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK290073 mRNA Translation: BAF82762.1 Different initiation.
AC000068 Genomic DNA No translation available.
AC000079 Genomic DNA No translation available.
AC000085 Genomic DNA No translation available.
AC000092 Genomic DNA No translation available.
CH471176 Genomic DNA Translation: EAX03039.1
CH471176 Genomic DNA Translation: EAX03040.1 Sequence problems.
CH471176 Genomic DNA Translation: EAX03041.1
BC062599 mRNA Translation: AAH62599.1 Different initiation.
CR456339 mRNA Translation: CAG30225.1 Different initiation.
RefSeqiNP_001159714.1, NM_001166242.1
NP_776154.3, NM_173793.4

3D structure databases

Database of comparative protein structure models

More...ModBasei		Search...

SWISS-MODEL Interactive Workspace

More...SWISS-MODEL-Workspacei		Submit a new modelling project...

Protein-protein interaction databases

BioGRIDi126177, 45 interactors
IntActiQ6P5X5, 41 interactors
MINTiQ6P5X5
STRINGi9606.ENSP00000382474

PTM databases

iPTMnetiQ6P5X5
PhosphoSitePlusiQ6P5X5

Polymorphism and mutation databases

BioMutaiC22orf39
DMDMi510120816

Proteomic databases

EPDiQ6P5X5
MassIVEiQ6P5X5
MaxQBiQ6P5X5
PaxDbiQ6P5X5
PeptideAtlasiQ6P5X5
PRIDEiQ6P5X5
ProteomicsDBi26215
67009 [Q6P5X5-1]

Protocols and materials databases

Antibodypedia a portal for validated antibodies

More...Antibodypediai		76439, 9 antibodies

The DNASU plasmid repository

More...DNASUi		128977

Genome annotation databases

EnsembliENST00000399562; ENSP00000382474; ENSG00000242259 [Q6P5X5-1]
ENST00000542103; ENSP00000439212; ENSG00000242259 [Q6P5X5-2]
ENST00000611555; ENSP00000479673; ENSG00000242259 [Q6P5X5-1]
GeneIDi128977
KEGGihsa:128977
UCSCiuc002zpi.4, human [Q6P5X5-1]

Organism-specific databases

Comparative Toxicogenomics Database

More...CTDi		128977
DisGeNETi128977
EuPathDBiHostDB:ENSG00000242259.8

GeneCards: human genes, protein and diseases

More...GeneCardsi		C22orf39
HGNCiHGNC:27012, C22orf39
HPAiENSG00000242259, Low tissue specificity
neXtProtiNX_Q6P5X5
OpenTargetsiENSG00000242259
PharmGKBiPA162378995

GenAtlas: human gene database

More...GenAtlasi		Search...

Phylogenomic databases

eggNOGiENOG502S4W2, Eukaryota
GeneTreeiENSGT00390000002511
HOGENOMiCLU_2164004_0_0_1
InParanoidiQ6P5X5
OMAiPRPCETY
OrthoDBi1541651at2759
PhylomeDBiQ6P5X5
TreeFamiTF324380

Enzyme and pathway databases

PathwayCommonsiQ6P5X5

Miscellaneous databases

BioGRID ORCS database of CRISPR phenotype screens

More...BioGRID-ORCSi		128977, 7 hits in 834 CRISPR screens

ChiTaRS: a database of human, mouse and fruit fly chimeric transcripts and RNA-sequencing data

More...ChiTaRSi		C22orf39, human

Database of phenotypes from RNA interference screens in Drosophila and Homo sapiens

More...GenomeRNAii		128977
PharosiQ6P5X5, Tdark

Protein Ontology

More...PROi		PR:Q6P5X5
RNActiQ6P5X5, protein

Gene expression databases

BgeeiENSG00000242259, Expressed in gastrocnemius and 212 other tissues
ExpressionAtlasiQ6P5X5, baseline and differential
GenevisibleiQ6P5X5, HS

Family and domain databases

InterProiView protein in InterPro
IPR021475, DUF3128
PANTHERiPTHR28052, PTHR28052, 1 hit
PfamiView protein in Pfam
PF11326, DUF3128, 1 hit

ProtoNet; Automatic hierarchical classification of proteins

More...ProtoNeti		Search...

MobiDB: a database of protein disorder and mobility annotations

More...MobiDBi		Search...

<p>This section provides general information on the entry.<p><a href='/help/entry_information_section' target='_top'>More...</a></p>Entry informationi

<p>This subsection of the 'Entry information' section provides a mnemonic identifier for a UniProtKB entry, but it is not a stable identifier. Each reviewed entry is assigned a unique entry name upon integration into UniProtKB/Swiss-Prot.<p><a href='/help/entry_name' target='_top'>More...</a></p>Entry nameiCV039_HUMAN
<p>This subsection of the 'Entry information' section provides one or more accession number(s). These are stable identifiers and should be used to cite UniProtKB entries. Upon integration into UniProtKB, each entry is assigned a unique accession number, which is called 'Primary (citable) accession number'.<p><a href='/help/accession_numbers' target='_top'>More...</a></p>AccessioniPrimary (citable) accession number: Q6P5X5
Secondary accession number(s): A8MTW6
, D3DX18, F5H3A8, J3KNP9
<p>This subsection of the 'Entry information' section shows the date of integration of the entry into UniProtKB, the date of the last sequence update and the date of the last annotation modification ('Last modified'). The version number for both the entry and the <a href="http://www.uniprot.org/help/canonical%5Fand%5Fisoforms">canonical sequence</a> are also displayed.<p><a href='/help/entry_history' target='_top'>More...</a></p>Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: May 29, 2013
Last modified: December 2, 2020
This is version 128 of the entry and version 2 of the sequence. See complete history.
<p>This subsection of the 'Entry information' section indicates whether the entry has been manually annotated and reviewed by UniProtKB curators or not, in other words, if the entry belongs to the Swiss-Prot section of UniProtKB (<strong>reviewed</strong>) or to the computer-annotated TrEMBL section (<strong>unreviewed</strong>).<p><a href='/help/entry_status' target='_top'>More...</a></p>Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

<p>This section contains any relevant information that doesn't fit in any other defined sections<p><a href='/help/miscellaneous_section' target='_top'>More...</a></p>Miscellaneousi

Keywords - Technical termi

Reference proteome

Documents

  1. Uncharacterized protein families (UPF)
    List of uncharacterized protein family (UPF) entries
  2. SIMILARITY comments
    Index of protein domains and families
  3. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again